KEGG   Nannochloropsis gaditana: NGA_0387300Help
Entry
NGA_0387300       CDS       T02917                                 

Gene name
PPX
Definition
protoporphyrinogen IX oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ngd  Nannochloropsis gaditana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NGA_0387300 (PPX)
Enzymes [BR:ngd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     NGA_0387300 (PPX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 620 aa AA seqDB search
AHGYPRREAAPLKKSNLGQWHALLRGASSTSIVLRGDFIGRRTKMIPCRQSLGLPVAVAL
LSCVFLSVRAFHLPSPAIRTRISSSTSISASHGRPRSLPSLYASSTSSPPAFGQFLTDLL
GDLFAGPEKVEETDVLVVGSGISGSTTAFYLNKAGVKCLLTEAKPVVGGNVISKSESGFL
WEEGPNSFQPTYPLMQATVDMGLADELVLADASLPRFVYWKEKLYALPGGLGDIPFFNLL
SIPGRIRAGLGALGFIRGPPKDKEESVKEFVTRHLGAETFERIIDPFVSGVYAGDPSKLS
MKAALKKVKRLEELGGRGILDGALLRIQEIQRTKPPVVPEHPVYKGGQLGSFKRGLQSMP
LAAAKALGKEKVRLSHKLLSVVEGKGPKGGYEAVFQTPQGRKRIKCQALAITAPAHVVHK
LLRPLVPEAARLADVYYPPVASVTLAYPKTAFREPLRGFGNLIPRSMKIRTLGTIWSSSL
FPGGPPDYNMLLSYIGGAQDPGIAELSSQQIVKEVDRDIKKVLLKPDAPAPKILGVRLWP
TAIPQYNKGHLDILASVEAGVKKHPGLFLGGNYRTGVAFGDCVTYGMEEAGRIQSYLAAK
APAPQTSVPPSPPSALAPGP
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
gcacacggctatccgaggagagaggcagcaccactcaagaaatcaaatctcggtcagtgg
cacgcgttgcttcgcggagcttcttccacttccatagttttgaggggtgattttattggc
cgcagaaccaaaatgatcccttgtcgtcagagcctgggcctccccgtggcagttgccctc
ctgtcctgcgtattcctctctgtgagggctttccacctgccttcccccgccatcagaaca
cgtatatccagcagcacgtctatcagtgcaagccatgggcgccctcgctcccttccctcc
ctctacgcctcctccacctcatctccccctgcattcgggcagtttttgaccgacctcctt
ggcgatcttttcgcgggccccgagaaagtggaggaaaccgacgttctggtggtgggctct
gggatcagtggctcgaccaccgcgttttatctgaacaaagctggagtcaagtgtctgctg
acagaggccaaacccgtggtgggagggaacgtgatcagtaaatcggagtccggcttcttg
tgggaggagggcccgaattccttccaacccacttatccgctcatgcaagcgactgtagac
atgggcctggccgatgaactggtcctggcagacgcgagcttgccccgcttcgtgtattgg
aaggagaaactctacgccctgcctgggggcttgggtgacatccccttcttcaatctccta
tccatacccggacgtatcagggcgggtctgggggctctgggcttcattcgaggcccgccg
aaggataaggaggagagcgtcaaggaattcgtgacccggcatttgggggcagagaccttc
gagcggatcatcgaccccttcgtctcgggcgtctacgccggggacccgagcaagctctcc
atgaaggcggccctgaagaaggtgaaacgcttggaggagctgggagggaggggcattctg
gacggggctttgcttcgcatccaggagatccaacggaccaagccgccggtggtgccggag
caccctgtgtacaagggcgggcagctgggttcattcaagcgaggcttgcagtcgatgccc
ctggcggcggccaaggcgctggggaaggagaaggtccggctctcccacaagctcttgagc
gtggtggaagggaaagggccgaagggtggctacgaggcggtttttcagaccccccaggga
cggaaacggatcaaatgccaggccctagccatcaccgcccccgcccacgttgtgcacaag
ctcctgcgtcctttggtcccggaggcggcccgtcttgccgacgtgtactatcccccggtc
gcctccgtcaccttggcctacccgaaaaccgcctttcgggagccgttgcggggtttcgga
aatttgattccccggagcatgaagatccgaacgctggggaccatctggtcgtcctccctc
ttcccgggcggcccccccgactacaacatgctgctttcctacatcggaggggcccaagat
ccgggtatcgcggagctgagcagccagcagatcgtcaaggaggtagacagggatatcaag
aaggtcttgctcaagcccgacgccccggcgcccaagatcctgggcgtgcggctgtggccc
accgccatcccgcagtacaacaagggccacctggacatcctcgcgagcgtggaggcaggg
gtcaagaaacatccgggtctctttttgggggggaattaccgaacaggcgtggcgtttggg
gactgcgtgacctacgggatggaggaagcgggcaggattcagagctacttggctgctaag
gctccggcaccgcaaacctcagtccctccttcccctccttcggcccttgcgcccggcccc

DBGET integrated database retrieval system