KEGG   Nannochloropsis gaditana: NGA_0481100Help
Entry
NGA_0481100       CDS       T02917                                 

Gene name
CHK
Definition
choline/ethanolamine kinase (EC:2.7.1.32)
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ngd  Nannochloropsis gaditana
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NGA_0481100 (CHK)
Enzymes [BR:ngd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     NGA_0481100 (CHK)
    2.7.1.82  ethanolamine kinase
     NGA_0481100 (CHK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 375 aa AA seqDB search
MTDQPTPAMVAAILRDVGLLNVESEENISVCAISGGNTNRVYRVSHTGATARGGTRDFLL
RLFGYGTEVFIDRQQEALIYRAVSSQGLCPKLLATFSEGRIEEFVPGQPLSAKQFRSGAF
SALIARQLRAFHSIADVKGLPKPTIPPLIAQLRAWATKARSVCGSAWGGIDVASLEGEVD
RLEARLLAVSSPVCLCHNDVNHLNILLRPTKLETPGQGTSEGTESEIAGCHSNAGCAATT
PALGPVAGDDIVFIDLEYAGWNYRGFDLGNLLCEWASDFQSPHPCELDFSSHYPTTEEQK
HIARAYLGSGAQGEAIEALVIEMNEFALASHLLWGMWGLIQSKMSTSEFESVSYAQQRLA
AYFEGMRRHQRQQGS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcagcctacacctgcgatggttgccgccattttacgagatgtggggcttttg
aatgtggagagtgaggaaaatataagcgtgtgtgccatttctggaggcaacacaaatcgt
gtctatcgcgtgagccacacgggagccacggcgagggggggaacgcgggacttcctctta
cgccttttcggttatggaactgaggtctttatcgatcgacaacaagaagcactgatctat
cgtgctgtctcgtcacagggactatgcccaaaacttcttgcgacattttccgagggtcgc
atcgaagaattcgtacctggtcaaccgctgagtgccaaacagttccggtccggcgccttc
tcggccctgatagccagacagcttcgggcatttcatagtattgcagacgtcaagggcttg
ccaaagccaaccattccacctttaatcgctcagcttcgcgcgtgggcgacgaaagcgaga
tctgtgtgtggcagtgcctggggaggcatcgacgttgcatccctggaaggagaggtcgat
cggctcgaagcccgtttgcttgccgtctcaagcccagtatgcctctgccataatgatgtc
aaccacttgaacatcctcctgcgccccacaaagctggagacccctggacaaggtacctcg
gaggggacagagagcgagatcgctggctgccattccaacgctggttgcgcagcgaccacg
ccagcccttggcccagtagcaggcgacgatatcgttttcatcgatcttgaatatgctgga
tggaattaccgtggctttgacctgggtaatcttctctgcgagtgggccagtgacttccaa
agcccccacccctgcgaacttgatttttcttcacactaccctacgaccgaggagcaaaag
catatcgcgcgcgcttacctgggaagtggagcacaaggggaggcaatcgaagcgctggtc
attgaaatgaatgagttcgctttagcatcacatttgctctggggcatgtggggtctgatc
caatcgaagatgtccacctccgagtttgagtcagtgagctatgcacagcagcggctggcg
gcgtattttgaagggatgagaagacaccagaggcaacaagggtcttaa

DBGET integrated database retrieval system