KEGG   Nannochloropsis gaditana: NGA_0496600Help
Entry
NGA_0496600       CDS       T02917                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme l3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ngd  Nannochloropsis gaditana
Brite
Enzymes [BR:ngd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NGA_0496600
Peptidases [BR:ngd01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   NGA_0496600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 223 aa AA seqDB search
MQKYVLSLGLIPTFYKFTDVLCTEEWALEMVVPPVLALIFLYPIKPANEIFRQEEDARIK
AHGQIVSPRLFFTKQTVGNACGTVGLLHALLNNKDKLEFREGSFLESFAERTQDKTPDER
AVILEEDEGLDAAHGCAAADGQSQQVPMEEAINTHFVIFVEKDGYLYELDGRKNFPINHG
KSSPETLLQDAMAVVRRVIAMDPQELKFTMVALSSAAGGQEEE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatacgtgctaagcctcggcctcatccccactttctacaaatttaccgatgtt
ctctgcactgaggagtgggcgcttgagatggttgttcctcctgtccttgccctcatcttc
ctgtaccccatcaagcctgcgaacgagattttccgtcaagaggaagatgcccgtatcaaa
gcgcatgggcaaattgtctcgccacgcctgtttttcaccaagcaaaccgtcgggaacgct
tgcgggacggtcgggctcctgcacgctctcctcaacaacaaggacaaactcgagttccga
gagggaagcttcctggaaagttttgcagagcggacgcaagacaagacccctgatgagcgg
gcggtgattctggaggaggacgaaggcttggatgccgcccatggttgcgccgcggccgac
ggccaaagccagcaagtcccgatggaagaagcaatcaatacgcacttcgtcattttcgtc
gagaaggatggctacctgtacgagctggacgggcggaaaaatttccccatcaaccacggg
aaatcctccccggagacgctcctgcaggacgcgatggcggtggtgcgacgagtgatagcg
atggacccacaggagctcaagttcacgatggtggcgttgagcagcgccgcgggggggcag
gaggaagagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system