KEGG   Nannochloropsis gaditana: NGA_2076800Help
Entry
NGA_2076800       CDS       T02917                                 

Definition
elongator complex protein 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ngd  Nannochloropsis gaditana
Brite
Enzymes [BR:ngd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NGA_2076800
Transfer RNA biogenesis [BR:ngd03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NGA_2076800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 593 aa AA seqDB search
MASSICTHPISIMPPNHSDIDQAQNRLSPAYLSCVAELVKELMHAFDARVPTNLTRLTAD
LARKRKLKIMPRLMDIIAAVPEEYRDKLLPFIKSKPVRTASGIAVVAVMCKPHRCPHIAM
TGNVCVYCPGGPDSDFEYSTQAYTGYEPTSMRAIRARYHPYAQTRGRVDQLKRLGHSVDK
VEFIVMGGTFMSLSEDYKDWFIRNLHDALSGHSSGSVAEAVAYMEHSESKCIGITIETRP
DFCLKPHLNEMLSYGCTRIEIGVQSIYEDVARDTNRGHTVHAVCNSFQLAKECGFKVVTH
MMPDLPNMGMERDLLGFREFFENPLFRADGLKIYPTLVIRGTGLYELWKTGQYKNYTPDE
LIDLMAKILSLVPPWTRIYRIQRDIPMPLVTAGVENGNLRELALRRMAELDLPCRDVRTR
EVGIRQIHQSARPHEIELVRRDYTANGGWETFLSYEDPHQDILIGLLRLRRPSAVTFRPE
ILNNFSSVVRELHVYGSAVPLHDRDPNKFQHQGYGRLLMEEAERIAKHEHGSAKIVVIAG
VGTRNYYRKLGYELEGPYMSKYLQKGNRPPVEYQAGKMHIDGLEMDERNGLQL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctagtatttgtacacaccctatcagcatcatgccgcccaatcattcggatata
gaccaagcacagaatcgcctttcgcccgcttacctcagttgcgttgcagagcttgtcaag
gaattgatgcatgcgtttgacgcccgagttcctacgaatttgacaaggttaacagccgat
ttagcacggaagcggaaactgaaaatcatgcctcgtttgatggacatcattgctgctgtc
cctgaggaatacagggataagttgttgcctttcattaaatcgaagccggttcgtacggcc
tctggtatcgccgtcgtagcagtcatgtgcaagcctcaccgttgtcctcatattgcgatg
actggcaacgtctgtgtatattgtcccggcggacctgactcggattttgaatactccaca
caagcctatactggctatgagcctacaagtatgcgggccattagggcgcgttatcacccg
tatgcccagacgcgtgggcgggtggatcaacttaaacgtttgggtcacagcgttgacaag
gtagaatttatcgtcatgggtggtacattcatgtccttgagcgaggattacaaagactgg
tttatccgcaatcttcatgatgctctctctggtcattcgtcgggcagtgtggccgaagct
gtcgcctacatggagcatagcgaaagtaaatgcattggtattactatcgagactaggcca
gatttttgtcttaaaccacatttgaacgagatgctatcttacggctgtactcgcatcgaa
atcggagttcagagcatttatgaggacgtggctcgagacacaaaccgaggtcacactgtt
cacgccgtgtgtaactcatttcaactggcaaaggagtgcgggttcaaggtcgtgacacac
atgatgccagatctacccaacatgggcatggagagggatcttctaggtttccgcgaattt
tttgagaaccctttgttccgagcagatggcttgaaaatatatcctactcttgttatccga
ggcacaggtttatatgagctttggaaaacaggacaatacaaaaattatactcccgacgaa
ctcatagatttgatggcaaagatcttatctcttgtcccaccttggactcgtatttaccgt
atccaacgggatatcccaatgcctctcgtcactgccggtgttgagaatggtaatcttaga
gagttggcgttgcgccggatggctgaactcgatcttccttgtcgagacgtccggacgcgc
gaagtaggtattcgtcaaattcatcaaagtgctcgcccacatgagattgagcttgttcgt
cgcgactatacggcaaatggcggatgggaaacttttctgagctacgaagatcctcaccaa
gacatccttattgggttgctacgtctccgaaggcctagcgctgttacatttcgtcctgag
atcctgaacaatttctcttccgttgtaagggagctgcatgtctacggctcagccgttccc
ttacacgatagagatccaaataaatttcaacaccaaggttacggcaggcttcttatggag
gaggcagaacgcattgccaaacatgagcatggttctgcgaagatagtagtgatagcagga
gtaggaactagaaattattatcgcaagctcggatatgaactggaagggccttacatgagt
aagtacttgcaaaaaggcaacagaccacccgtagagtatcaagcgggcaaaatgcatatc
gatggattggaaatggatgaaagaaatggcctacaactgtga

DBGET integrated database retrieval system