KEGG   Natronobacterium gregoryi: Natgr_0115Help
Entry
Natgr_0115        CDS       T02383                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nge  Natronobacterium gregoryi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nge00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(114258..116330)
Genome map
AA seq 690 aa AA seqDB search
MERHRAPFSAIVGQEELKRALLAVAVDDGLDGVLVQGEKGTAKSTAVRGLVDLLPDQRAV
ADCPYGCPPDDPASQCETCRSRDHDDLAVETRPVPLVTLPLGATRESVVGTLSVADALEG
EAEFDPGLLAQANRGFLYVDEVNLLEDHLVDVLLDAAASGVNRVERDGVSVSHPADFTLI
GTMNPEEGELRPQLRDRFSLQATVTGCRDVDDRIAVIDRALERNADPETFAAGYEADIAA
RRQQLREARDLLETVSLPDEFKREIADLCLDAGVDGHRGDIAIARTARTLAALEGRRKVI
QPDVTEAARLALPHRLQSRPFEDAPDPEDVLEDHFDEDDEERDGEGEADESEASSDEASE
DDEPRNDARGDGSGDSSDTGSNGADSSSQPSSDASDDDDGTGDGEPEDADAPAEGDDEDE
ATPLVPGQQRAEIGDAERPPVDDVEADASTRGDGTRVRAQASDRGRGARVRTERATADES
VDTAASVRAAATDGRTRVEEGDLRKSVRQSRAGSLIVFVVDASASMRPAMAEAKGTVMNL
LQDAYEHRDEVAFVAVAGEEAEVALPPTDSVTLAARHLKELPTGDRTPLPSGLEEATRLV
TRTDADASLVVVVTDGRANVAEGSPTASTREAARRLARTDSEVVVVDAGDDGAGLVGILE
TETGGKRLPLSELSAERVAETASAVGCGEN
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcaccgagcgccgttttcggcgatcgtcggacaggaggaactgaagcgggcg
ttgctcgccgttgcagtcgacgacggactcgacggcgtgctcgttcagggggagaaagga
accgcgaagtcgacagccgtccgcggactcgtcgacctgctacccgaccaacgggccgtc
gcggactgtccgtacggctgtccacccgacgatccggccagccagtgtgagacgtgtcga
tcgcgcgaccacgacgacctcgcagtcgaaacccggcccgttccgctggtaacacttccg
ctcggagcaacccgcgagagcgtcgtcggaacgctctccgttgccgacgcactcgagggc
gaggcagagttcgatcccggactgctcgcgcaggcgaatcgggggttcctgtacgtcgac
gaggtcaacctgctcgaggaccacctcgtggacgtcctcctcgatgcggccgcgagcggc
gtcaaccgtgtcgaacgcgacggcgtaagcgtctctcatcccgccgacttcaccctgatc
gggacgatgaaccccgaagagggcgagttgcggccacagctccgggatcgattttccctc
caggcgaccgtcaccggctgtcgtgacgtcgacgaccgcatcgcggtgatcgatcgtgca
ctcgagcgaaacgccgatcccgaaacgttcgccgccggctacgaggccgatatcgccgcc
cgacgacagcagctacgcgaggcacgggacctgctcgagacggtttccctccccgacgag
ttcaagcgcgaaatcgccgacctctgtctcgacgcgggcgtcgacggccaccgcggagac
atcgccatcgcccgtactgcccggacgctcgctgcgctcgagggtcgccggaaggtgatc
caacccgacgtgacggaggccgctcggctggcgctaccacatcgcctccagagtcgaccg
ttcgaggacgcgccggacccggaggacgtactcgaggatcacttcgacgaggacgacgag
gagagagacggcgagggcgaagccgacgagtcggaagcgagcagcgacgaagcgagcgag
gacgacgaaccccgaaacgacgctcgaggcgacggctccggcgactcgagtgacactggc
agtaacggcgctgacagctcgagccagccctcgagtgacgcctccgacgatgacgacgga
actggagacggtgagccggaggatgcggacgcgccagccgagggcgacgacgaagacgag
gcgacgccgctcgtcccgggccagcaacgggccgaaatcggcgatgcagaacggccgccc
gtcgacgacgtcgaagctgacgcgtcgactcgaggcgatggcactcgagtgcgcgcacag
gcgtcggaccgcggccgtggcgcacgggtgcggacggagcgtgcaaccgccgacgagtcg
gtcgacacggccgcgtcggtccgggccgctgcgactgacggtcggacgcgcgtcgaggaa
ggcgacctccgaaaatccgtcagacaatctcgagccggttccctgatcgtcttcgtcgtc
gacgccagcgcctccatgcgtccggcgatggccgaggccaaggggacggtcatgaacctg
ctgcaggacgcctacgaacaccgcgacgaagtggcgttcgtggccgtcgccggcgaggag
gccgaagtcgccctgccgccgaccgatagcgtcacgctcgccgctcgccatctgaaggaa
ctcccgaccggtgaccggacgccgctgccgtcgggtctcgaggaagccacccgactcgtg
acgcgaaccgacgctgacgcgagcctcgtggtcgtcgtgaccgacgggcgggcgaacgtc
gctgagggaagcccgacggcgagtacgcgagaagcggcgcgtcgactggctcgaaccgat
tccgaggtcgtggtcgtcgacgccggcgacgatggggcagggctggtcggcatcctcgaa
accgaaaccggggggaaacggctcccactctcggagctctcggccgagcgggtggcagaa
acggcatcggcggtcggatgcggagaaaattag

DBGET integrated database retrieval system