KEGG   Natronobacterium gregoryi: Natgr_0115Help
Entry
Natgr_0115        CDS       T02383                                 

Definition
(GenBank) Mg-chelatase subunit ChlI
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nge  Natronobacterium gregoryi
Pathway
nge00860  Porphyrin and chlorophyll metabolism
nge01100  Metabolic pathways
nge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Natgr_0115
Enzymes [BR:nge01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Natgr_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA AAA_5 MCM VWA_3 Sigma54_activat
Motif
Other DBs
NCBI-ProteinID: AFZ71380
UniProt: L0AE91
Position
complement(114258..116330)
Genome map
AA seq 690 aa AA seqDB search
MERHRAPFSAIVGQEELKRALLAVAVDDGLDGVLVQGEKGTAKSTAVRGLVDLLPDQRAV
ADCPYGCPPDDPASQCETCRSRDHDDLAVETRPVPLVTLPLGATRESVVGTLSVADALEG
EAEFDPGLLAQANRGFLYVDEVNLLEDHLVDVLLDAAASGVNRVERDGVSVSHPADFTLI
GTMNPEEGELRPQLRDRFSLQATVTGCRDVDDRIAVIDRALERNADPETFAAGYEADIAA
RRQQLREARDLLETVSLPDEFKREIADLCLDAGVDGHRGDIAIARTARTLAALEGRRKVI
QPDVTEAARLALPHRLQSRPFEDAPDPEDVLEDHFDEDDEERDGEGEADESEASSDEASE
DDEPRNDARGDGSGDSSDTGSNGADSSSQPSSDASDDDDGTGDGEPEDADAPAEGDDEDE
ATPLVPGQQRAEIGDAERPPVDDVEADASTRGDGTRVRAQASDRGRGARVRTERATADES
VDTAASVRAAATDGRTRVEEGDLRKSVRQSRAGSLIVFVVDASASMRPAMAEAKGTVMNL
LQDAYEHRDEVAFVAVAGEEAEVALPPTDSVTLAARHLKELPTGDRTPLPSGLEEATRLV
TRTDADASLVVVVTDGRANVAEGSPTASTREAARRLARTDSEVVVVDAGDDGAGLVGILE
TETGGKRLPLSELSAERVAETASAVGCGEN
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcaccgagcgccgttttcggcgatcgtcggacaggaggaactgaagcgggcg
ttgctcgccgttgcagtcgacgacggactcgacggcgtgctcgttcagggggagaaagga
accgcgaagtcgacagccgtccgcggactcgtcgacctgctacccgaccaacgggccgtc
gcggactgtccgtacggctgtccacccgacgatccggccagccagtgtgagacgtgtcga
tcgcgcgaccacgacgacctcgcagtcgaaacccggcccgttccgctggtaacacttccg
ctcggagcaacccgcgagagcgtcgtcggaacgctctccgttgccgacgcactcgagggc
gaggcagagttcgatcccggactgctcgcgcaggcgaatcgggggttcctgtacgtcgac
gaggtcaacctgctcgaggaccacctcgtggacgtcctcctcgatgcggccgcgagcggc
gtcaaccgtgtcgaacgcgacggcgtaagcgtctctcatcccgccgacttcaccctgatc
gggacgatgaaccccgaagagggcgagttgcggccacagctccgggatcgattttccctc
caggcgaccgtcaccggctgtcgtgacgtcgacgaccgcatcgcggtgatcgatcgtgca
ctcgagcgaaacgccgatcccgaaacgttcgccgccggctacgaggccgatatcgccgcc
cgacgacagcagctacgcgaggcacgggacctgctcgagacggtttccctccccgacgag
ttcaagcgcgaaatcgccgacctctgtctcgacgcgggcgtcgacggccaccgcggagac
atcgccatcgcccgtactgcccggacgctcgctgcgctcgagggtcgccggaaggtgatc
caacccgacgtgacggaggccgctcggctggcgctaccacatcgcctccagagtcgaccg
ttcgaggacgcgccggacccggaggacgtactcgaggatcacttcgacgaggacgacgag
gagagagacggcgagggcgaagccgacgagtcggaagcgagcagcgacgaagcgagcgag
gacgacgaaccccgaaacgacgctcgaggcgacggctccggcgactcgagtgacactggc
agtaacggcgctgacagctcgagccagccctcgagtgacgcctccgacgatgacgacgga
actggagacggtgagccggaggatgcggacgcgccagccgagggcgacgacgaagacgag
gcgacgccgctcgtcccgggccagcaacgggccgaaatcggcgatgcagaacggccgccc
gtcgacgacgtcgaagctgacgcgtcgactcgaggcgatggcactcgagtgcgcgcacag
gcgtcggaccgcggccgtggcgcacgggtgcggacggagcgtgcaaccgccgacgagtcg
gtcgacacggccgcgtcggtccgggccgctgcgactgacggtcggacgcgcgtcgaggaa
ggcgacctccgaaaatccgtcagacaatctcgagccggttccctgatcgtcttcgtcgtc
gacgccagcgcctccatgcgtccggcgatggccgaggccaaggggacggtcatgaacctg
ctgcaggacgcctacgaacaccgcgacgaagtggcgttcgtggccgtcgccggcgaggag
gccgaagtcgccctgccgccgaccgatagcgtcacgctcgccgctcgccatctgaaggaa
ctcccgaccggtgaccggacgccgctgccgtcgggtctcgaggaagccacccgactcgtg
acgcgaaccgacgctgacgcgagcctcgtggtcgtcgtgaccgacgggcgggcgaacgtc
gctgagggaagcccgacggcgagtacgcgagaagcggcgcgtcgactggctcgaaccgat
tccgaggtcgtggtcgtcgacgccggcgacgatggggcagggctggtcggcatcctcgaa
accgaaaccggggggaaacggctcccactctcggagctctcggccgagcgggtggcagaa
acggcatcggcggtcggatgcggagaaaattag

DBGET integrated database retrieval system