KEGG   Natronobacterium gregoryi: Natgr_0459Help
Entry
Natgr_0459        CDS       T02383                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nge  Natronobacterium gregoryi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natgr_0459
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natgr_0459
   00052 Galactose metabolism
    Natgr_0459
   00500 Starch and sucrose metabolism
    Natgr_0459
   00520 Amino sugar and nucleotide sugar metabolism
    Natgr_0459
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Natgr_0459
   00524 Butirosin and neomycin biosynthesis
    Natgr_0459
Enzymes [BR:nge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Natgr_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(455539..456516)
Genome map
AA seq 325 aa AA seqDB search
MVYYAGVDLGATNVRAAVGDDDGTTIGVSRNETPRGPTGIDVTEGVLRTFREACDDAGIE
PTWIEAAGIGSIGPFDLAEGAVIDPANLPDSIDRIPLTGPIEKLIDSEEVYLHNDTNAGV
IGERFHADRNPDDMVYITISSGIGAGVCCDGEILDGWDGNAGEVGHTVVDPRGRLTCGCG
HDGHWEAYCSGNGIPEYTRLLAEDDPTIETSLPLEDPAFTARDVFELAGEDELADYTIEQ
LVHWNALGVTNVVQSFAPLVVSFGGAVALYNEKLVVDPIRERVSEMLLNNVPEFRVTDHG
DDVVLEGALASAMTGGTGDRRKFTT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtctattacgccggcgtcgacctcggcgcgaccaacgtacgggccgccgtcggagac
gacgacggaacgacgatcggtgtcagtcgtaacgaaacgccacgcggacccaccggaatc
gacgtgacggaaggcgtcctccggacgtttcgcgaggcctgtgatgacgctgggatcgaa
cccacctggatcgaggcggcggggatcggctcgatcggtccgttcgacctcgcggaaggg
gcagtgatcgacccggccaacctccccgactcgatcgaccggattccgctcaccggtccg
atcgagaaactgatcgacagcgaggaggtctacctccacaacgacacgaacgcgggcgtc
atcggcgagcggttccacgccgatcgcaaccccgacgacatggtctacatcacgatctcc
tcggggatcggcgcaggcgtctgctgtgacggcgaaattctcgacggctgggacggcaac
gcgggcgaagtcggccacaccgtcgtcgacccgcgcggtcgcctgacctgtggctgtggc
cacgacggccactgggaggcctactgctcgggcaacggcatccccgagtacacacgacta
ctcgccgaagacgacccgacgatcgagacgagtctgccgctcgaggaccccgcgttcacg
gcgcgagatgtctttgaactggcgggcgaggacgaactggccgactacacgatcgagcaa
ctcgtccactggaacgcactcggtgtcacgaacgtcgtccagtcgttcgcgccgctcgtc
gtctccttcggcggtgccgttgcactctacaacgagaagttggtcgtcgacccgatccgc
gagcgcgtctccgagatgttgctgaacaacgtccccgagtttcgcgtcaccgaccacggc
gacgacgtcgtcctcgagggcgcactcgcgagtgcgatgacgggcggaactggtgatcgt
cgaaagttcacgacatag

DBGET integrated database retrieval system