KEGG   Natronobacterium gregoryi: Natgr_0459Help
Entry
Natgr_0459        CDS       T02383                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nge  Natronobacterium gregoryi
Pathway
nge00010  Glycolysis / Gluconeogenesis
nge00052  Galactose metabolism
nge00500  Starch and sucrose metabolism
nge00520  Amino sugar and nucleotide sugar metabolism
nge00521  Streptomycin biosynthesis
nge01100  Metabolic pathways
nge01110  Biosynthesis of secondary metabolites
nge01120  Microbial metabolism in diverse environments
nge01130  Biosynthesis of antibiotics
nge01200  Carbon metabolism
Module
nge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natgr_0459
   00052 Galactose metabolism
    Natgr_0459
   00500 Starch and sucrose metabolism
    Natgr_0459
   00520 Amino sugar and nucleotide sugar metabolism
    Natgr_0459
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Natgr_0459
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Natgr_0459
Enzymes [BR:nge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Natgr_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFZ71714
UniProt: L0AE61
Position
complement(455539..456516)
Genome map
AA seq 325 aa AA seqDB search
MVYYAGVDLGATNVRAAVGDDDGTTIGVSRNETPRGPTGIDVTEGVLRTFREACDDAGIE
PTWIEAAGIGSIGPFDLAEGAVIDPANLPDSIDRIPLTGPIEKLIDSEEVYLHNDTNAGV
IGERFHADRNPDDMVYITISSGIGAGVCCDGEILDGWDGNAGEVGHTVVDPRGRLTCGCG
HDGHWEAYCSGNGIPEYTRLLAEDDPTIETSLPLEDPAFTARDVFELAGEDELADYTIEQ
LVHWNALGVTNVVQSFAPLVVSFGGAVALYNEKLVVDPIRERVSEMLLNNVPEFRVTDHG
DDVVLEGALASAMTGGTGDRRKFTT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtctattacgccggcgtcgacctcggcgcgaccaacgtacgggccgccgtcggagac
gacgacggaacgacgatcggtgtcagtcgtaacgaaacgccacgcggacccaccggaatc
gacgtgacggaaggcgtcctccggacgtttcgcgaggcctgtgatgacgctgggatcgaa
cccacctggatcgaggcggcggggatcggctcgatcggtccgttcgacctcgcggaaggg
gcagtgatcgacccggccaacctccccgactcgatcgaccggattccgctcaccggtccg
atcgagaaactgatcgacagcgaggaggtctacctccacaacgacacgaacgcgggcgtc
atcggcgagcggttccacgccgatcgcaaccccgacgacatggtctacatcacgatctcc
tcggggatcggcgcaggcgtctgctgtgacggcgaaattctcgacggctgggacggcaac
gcgggcgaagtcggccacaccgtcgtcgacccgcgcggtcgcctgacctgtggctgtggc
cacgacggccactgggaggcctactgctcgggcaacggcatccccgagtacacacgacta
ctcgccgaagacgacccgacgatcgagacgagtctgccgctcgaggaccccgcgttcacg
gcgcgagatgtctttgaactggcgggcgaggacgaactggccgactacacgatcgagcaa
ctcgtccactggaacgcactcggtgtcacgaacgtcgtccagtcgttcgcgccgctcgtc
gtctccttcggcggtgccgttgcactctacaacgagaagttggtcgtcgacccgatccgc
gagcgcgtctccgagatgttgctgaacaacgtccccgagtttcgcgtcaccgaccacggc
gacgacgtcgtcctcgagggcgcactcgcgagtgcgatgacgggcggaactggtgatcgt
cgaaagttcacgacatag

DBGET integrated database retrieval system