KEGG   Natronobacterium gregoryi: Natgr_0465Help
Entry
Natgr_0465        CDS       T02383                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
nge  Natronobacterium gregoryi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nge00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461042..462349
Genome map
AA seq 435 aa AA seqDB search
MSDSTGASTSDEPTSVGVVGAGITGLALTHYLAERGLDVMTFESGSEPGGIVRSSQIDGR
VLEYGPQRARLVPEIEALVDELDLRDELVVADDDLPLYVYADGRLREVPRSLSTFFQTDL
LSWRGKCRLLVEPLTAPGQPDERAASLFARKFGLEAYRNVIEPLFGGLYGSDPADMPAEH
SLSRLLALEKRKGSLLRPAVDRLIRGGETPPPISFDSGLQALPEALYEAHRLYVHLNTTV
SSIETDGDGYALSAGGRTVTVDEVVVTSTASGAATILESLDGPTVAPLRELNYNSLVLVF
LEADAQTEGFGYQVRRDEALSTRGVTFNDSLFDRDGIYTVYLGGTSDPGAVDRSEEELAT
LARQEFQTVMGVDADVVEITRLPEVIPAFDTSWAALETVSLPDEITLAGNYTSRLGFPGR
FRQAKRIADRLAAES
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagtactggcgcgtcgacgtccgacgaacccacgagcgtcggcgtcgtcggt
gccgggatcactggcctcgcgctcacgcactacctcgccgagcgcggtctcgacgtcatg
accttcgagtctggctccgaacccggcgggatcgtgcgctcgagtcagatcgacggccgg
gtcctcgagtacggcccccagcgagctcggctcgtcccggagatcgaagcgttggtcgac
gagttggatctccgagacgagctggtggtggccgacgacgatctcccgctgtacgtctac
gccgacgggcgactccgggaagttccccgttcgctctcgacgtttttccagacggacctc
ctctcctggcgtgggaagtgtcgcctgctcgtcgaaccactgaccgcacccggccagccc
gacgagcgagcggccagtctgttcgcccggaagttcggcctcgaagcctaccgcaacgtg
atcgaaccgttgttcggcggactctatggctccgatccggccgatatgcccgccgaacac
tccctctcgcgactgctcgcactcgaaaagcggaagggatcgctcctgcggccggccgtc
gatcggttgattcgtggcggagagacgccgccccccatctcgttcgactcggggctccag
gcgcttcccgaggcactgtacgaggctcatcgcctgtacgttcacctgaacacgacggtc
agttcgatcgaaaccgacggggacggctacgccctctcggccggcggtcgaaccgtcacc
gtcgacgaagtcgtcgtgacctcgacggcgtctggagcagcgacgattctcgagagtctc
gatgggccgaccgtcgccccgctgcgggaactgaactacaactcgctggtgctcgtcttc
ctcgaggcagacgcccagaccgagggcttcggttaccaggtcagacgtgacgaggcgctg
tcgacccgtggtgtcaccttcaacgatagcctgttcgaccgcgatgggatctacaccgtc
tatctcggcggcacatctgaccccggtgcagtcgaccgatccgaggaggaactcgccaca
ttggctcgccaggagttccagacggtgatgggcgtcgacgccgacgtcgtcgaaataacg
aggctgcccgaggtaatcccagcgttcgacacctcgtgggcggctctcgaaaccgtctct
ctgcccgacgagatcacgctcgcgggcaactacacgtcccgcctcggcttccccggccgg
ttccggcaagcaaaacggatcgccgaccgactcgccgcggagtcgtga

DBGET integrated database retrieval system