KEGG   Natronobacterium gregoryi: Natgr_0491Help
Entry
Natgr_0491        CDS       T02383                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nge  Natronobacterium gregoryi
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natgr_0491
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Natgr_0491
   00650 Butanoate metabolism
    Natgr_0491
  Energy metabolism
   00190 Oxidative phosphorylation
    Natgr_0491
   00720 Carbon fixation pathways in prokaryotes
    Natgr_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492207..492572
Genome map
AA seq 121 aa AA seqDB search
MSERYSTFTPGGTGWLLQRITAAFLVVVLAFHFFQLHFVNHAADVTFAGTQARMENVGYF
LTMVLFLIAGAFHGLNGVYNALVNQGLKGTPKKIVFWVLVIAGVALIVQGTYVALAMAGW
S
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaacgctactccacgttcacgcctggtggaactggatggctcctccagcggatc
acggcggcgtttctcgtcgtcgtgctcgccttccacttcttccagcttcacttcgtcaat
cacgcggccgacgtgacgttcgctggcacgcaggcccgaatggaaaacgttggctacttc
ctgacgatggtgttgttcctgatcgccggcgcattccacggcctgaacggcgtctacaac
gccctagtcaaccagggcctcaaggggaccccaaagaaaatcgtgttctgggtccttgtc
atcgcaggtgtcgcgttgatcgtccaagggacctacgtcgcactcgctatggcgggatgg
agctaa

DBGET integrated database retrieval system