KEGG   Natronobacterium gregoryi: Natgr_0734Help
Entry
Natgr_0734        CDS       T02383                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
nge  Natronobacterium gregoryi
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nge00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
732708..733394
Genome map
AA seq 228 aa AA seqDB search
MTEAELLVSECRAVVDHAIELADLTPGRTGNLSVRGEPGGDGGSDSGPGNAFAITPTGVP
YDAFDPGDVPVVDIGTEGGQLAGEMTPSSEVPMHTAIYRREDVGAIVHTHSPWATALAVA
NEPLPPIHYMIVAVGKSVPVAEYAPYGTDDLAANIVAAMDEADSTAALIENHGLVVTAPD
LPTALENTHHVESLARLYLETKSAGLEPQTLSDEQLETVLEQFESYGQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcggaacttctggtgagtgagtgtcgggccgtcgtcgatcacgcgatcgaa
cttgccgatcttaccccgggtcggacggggaatctgagcgttcgtggcgagcccggaggt
gatggcggtagcgacagtggcccgggaaacgccttcgcgatcactccgactggcgtcccc
tacgacgcgttcgatcctggagacgtgccggttgtcgacatcggtaccgaaggtgggcaa
ctcgccggcgaaatgacaccgagcagcgaagtgccgatgcatacggcgatctatcggcgc
gaagacgtcggtgcgatcgtccatacccattcgccgtgggcgaccgcgctcgccgtcgca
aacgaaccgctgccgccgatccactacatgatcgtcgccgtcggcaaaagcgtccccgtc
gcagagtacgcaccctacggcaccgacgacctcgcggcgaacatcgtcgccgcgatggac
gaggccgactcgaccgccgcgctcatcgagaaccacggcctcgtcgtcaccgcgcccgac
ctcccaaccgcgctcgagaacacccatcacgtcgaaagcctcgcgcggctttacctcgag
acgaaatccgcggggctggagccccagacgctgtcggacgagcaactcgagacggtactc
gagcagttcgagtcctacgggcagtga

DBGET integrated database retrieval system