KEGG   Natronobacterium gregoryi: Natgr_0822Help
Entry
Natgr_0822        CDS       T02383                                 

Definition
(GenBank) peptidase family protein
Organism
nge  Natronobacterium gregoryi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M28 Peptidase_M20 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AFZ72063
UniProt: L0ADT0
Position
complement(817405..818472)
Genome map
AA seq 355 aa AA seqDB search
MPSTAFDFELLCELTETSGVPGYEDRIRDLVVDELEATVDRVRTDPMGNVVGTLEGSGDH
SVAVAAHMDEIGFMVRHVAGDEDGDGFVELDALGGWDARVLKAQRVTIHTDEGDLPGVIG
SPPPHTLDEEEREKTPKVEDVFVDVGLPYEELEERVSPGDLVTMDQTTERVGETVTGKAL
DDRVCLFAMLEAARRLEKPDATIHFCATVQEEVGLRGAHALGVDVDPDLAIALDVTVAND
VPGFDAGEYVTQLGEGTAIKLKDSSVITNPKVHKRMQSVADDAEIDYQLEILPAGGTDTA
GFQNTAGAKPVGAISIPTRYLHTVTETAHVDDVAATIDLLEAFLESEDGAHEYTL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgccatccaccgcattcgacttcgagttactatgcgaactgaccgaaacgagcggcgtc
ccgggttacgaagaccggattcgtgatctcgtcgtcgacgaactagaagcgacggtcgat
cgcgtacggaccgatccgatgggcaacgtcgtcggaacgctcgagggctcgggcgaccac
tcggtcgccgttgcggcccacatggacgaaatcggtttcatggtccgacacgtcgcaggc
gacgaagacggcgacgggttcgtcgaactggacgcactcggtggctgggacgcccgcgtc
ctcaaagcccagcgcgtgacgatccacaccgacgagggcgacctgccgggcgtcatcggc
tcgccgccaccacacaccttagacgaggaagaacgcgagaagacgccgaaagtcgaggac
gtcttcgtcgacgtcggcctcccctacgaggaactcgaggagcgggtctcgccgggcgac
ctcgtgacgatggaccagacgaccgaacgcgtcggcgagacggtgacgggcaaggcactc
gacgaccgcgtctgcctgttcgcgatgctcgaggcggcccgccgactcgaaaagcccgac
gcgacgatccacttctgtgcgaccgtccaggaggaagtcggcctacggggtgctcacgca
ctcggcgtcgacgtcgaccccgacctggcgatcgcactggacgtcaccgtcgccaacgac
gtccccggcttcgacgccggcgaatacgtcacccagctcggcgaggggacggcgatcaaa
ctcaaagactcgagcgtaatcacgaacccgaaggtccacaagcgcatgcagtcggtcgcc
gacgacgcggagatcgactaccaactcgagatccttcctgccggcggcaccgacacggcc
ggcttccagaacaccgccggcgcgaagcccgtcggcgcaatctcgatcccgacgcggtac
ctccacaccgtcaccgagacggcacacgtcgacgacgtggcagcgaccatcgacctcctc
gaggcgtttctcgagagcgaggacggagcacacgagtacacgctgtaa

DBGET integrated database retrieval system