KEGG   Natronobacterium gregoryi: Natgr_1135Help
Entry
Natgr_1135        CDS       T02383                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nge  Natronobacterium gregoryi
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Natgr_1135
Enzymes [BR:nge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Natgr_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1111781..1112668
Genome map
AA seq 295 aa AA seqDB search
MITVLTAGHVNWDVTLRVDRLPEPDGESAIRSQSQSGGGSAANVAAALAGLEVDAGLVGS
VGDDDNGVLARRDLEAAGVSLEGLRVVDDAETAVKYLLVDDEGEVAVLGNDGVNEAVAPD
DVDSDRIRSADHVHLTSQRPDTATRIAEIASDAGVTISFDPGRRLEDREYGNALALADIL
FANDREIASLLEGEYEHVGSEYGDRIVVVKHGGDGAKLHTPELTYDHPGFDVEPVDTAGA
GDAFAAGFLAVALTDGDLERALEYANACGALTASKEGARSAPTATTVEKFLRSQY
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgattacggtgcttaccgccgggcacgtcaactgggacgtcaccctccgcgtcgatcgc
ctccccgaacccgacggcgagtcagcgatccgctcccagtctcaatccggaggcggcagt
gccgccaacgtcgccgccgccctcgccggcctcgaggtcgacgccggcctcgtcggcagc
gtcggcgacgacgacaacggcgttctcgccagacgcgatctcgaggcggcgggcgtctcc
ctcgaggggctccgggtcgtcgacgacgccgagacagccgtcaagtacctgctcgtcgac
gacgagggcgaggtcgcagtactcggcaacgacggcgtcaacgaggccgtcgcgccggac
gacgtcgactccgaccgtatccgctcggcagaccacgtccacctcacgagccagcgaccc
gataccgccaccaggatcgccgagatcgcaagcgacgcaggcgtcacgatcagtttcgat
cccggacgccgactcgaggaccgggagtacggtaacgcgctcgcgctcgcggacattctc
ttcgccaacgacagggagatcgcctcgttgctcgaaggcgagtacgaacacgtcgggtcg
gagtacggtgatcggatcgtcgtcgtcaaacacggcggcgacggggcgaaactccacact
cccgaactgacctacgaccacccagggttcgacgtcgaaccagtcgatacggccggtgca
ggcgacgcgttcgcggctggctttctcgcggtggcgcttaccgacggcgacttagagcga
gcgctcgagtacgcgaacgcctgtggagcccttactgcgagcaaggaaggggcacggagt
gcgccgactgcgacgacggtcgagaagtttctgcgttcacagtattga

DBGET integrated database retrieval system