KEGG   Natronobacterium gregoryi: Natgr_1351Help
Entry
Natgr_1351        CDS       T02383                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nge  Natronobacterium gregoryi
Pathway
nge00010  Glycolysis / Gluconeogenesis
nge00020  Citrate cycle (TCA cycle)
nge00620  Pyruvate metabolism
nge01100  Metabolic pathways
nge01110  Biosynthesis of secondary metabolites
nge01120  Microbial metabolism in diverse environments
nge01130  Biosynthesis of antibiotics
nge01200  Carbon metabolism
Module
nge_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natgr_1351
   00020 Citrate cycle (TCA cycle)
    Natgr_1351
   00620 Pyruvate metabolism
    Natgr_1351
Enzymes [BR:nge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Natgr_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 GCV_H RnfC_N Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFZ72562
UniProt: L0AHC7
Position
complement(1338112..1339689)
Genome map
AA seq 525 aa AA seqDB search
MVREFKLPDVGEGVAEGELVSWLVEEGDTVSEDQPVAEVETDKALVEVPAPVTGTVQDRH
YEEGDVIPVGDVFITFEVEGEDDAEAAADTGEEATAETEADPAGSPGATGGDTDEVATPT
DRVFAPPRVRRLAREESVDLTTLEGSGPGGRITAADVGAAAGTAPEPEQAESTASSGTEA
GAGATETAASATSSTGGAATTGASQAPQSVESADRDRTLAAPATRRIAEEEGVDIDAVPA
SEQRDGEPFVTPEAVRKYAQAQQQAQEADRQAVEAGEPVGQKSADFEPGERERREPFRGV
RKTIADAMVESKYSAPHVTHHDEVDVTELVETREELKPRAEEKGIHLTYMPFITKAVVAA
LKEFPEMNAVIDEENEEIVYRDYYNVGVATATDVGLMVPVLENADGKGLLQISSEMNELV
EKARERSIAPDELQGSTFTITNIGGIGGEYATPILNYPESGILAVGEIKRKPRVIETDGE
ERIEPRSVMTLSLSFDHRLIDGAVGAQFTNKVLEYLENPNLLLLE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggtccgagaattcaagcttcccgacgtcggcgaaggagtcgccgagggcgaactggtc
tcgtggctcgtcgaagaaggcgacaccgtcagcgaggaccaaccggtcgcggaggtcgag
accgacaaggccctcgtggaggtacctgcaccggtcaccgggaccgttcaggaccgtcac
tacgaggaaggcgacgtgatcccggtcggcgacgtcttcatcaccttcgaggtagagggc
gaggacgacgccgaggctgcggctgacaccggcgaggaagcgacggccgagacggaggcc
gaccccgccggcagccccggcgcgaccggcggcgacaccgacgaagtcgcgacgccgacc
gaccgcgtcttcgcgccgccacgcgtccgccgactggcccgcgaagagagcgtcgacctc
accacactcgaggggtcgggtccgggcggccggatcactgcagcggacgtcggggcagcc
gccggtaccgcaccggagcccgaacaggccgaatcgacggcctcgagtggcactgaagcc
ggggctggagcgaccgaaaccgccgcgagtgcgacctcgagcactggtggcgctgcgacg
accggggcctctcaggcaccccagtccgtcgaatcggccgaccgcgaccgcaccctcgct
gcacctgcgacccggcgaatcgccgaagaggaaggcgtcgacatcgacgcggtcccggcg
agcgaacagcgcgacggcgaaccgttcgtcacgcccgaggctgtccgcaagtacgcccag
gcacagcagcaggcccaggaagccgaccgacaggctgtcgaggccggcgaaccggtcggg
cagaagagcgccgatttcgaacccggcgagcgcgagcgtcgcgagccgttccgtggcgtg
cgcaagaccatcgccgacgcgatggtcgagtccaagtacagcgcaccccacgtcacccac
cacgacgaggtcgacgtgaccgaactcgtcgaaacccgcgaagaactcaaaccgcgggcc
gaggagaagggcatccacctgacctacatgccctttatcacgaaggccgtcgtcgccgca
ctgaaggagttccccgagatgaacgcggtgatcgacgaggaaaacgaggagatcgtctac
cgcgactactacaacgtcggcgtcgccaccgcgaccgatgtcggactgatggtgccggtg
ctcgaaaacgccgacggcaagggactgctccagatctcctcggagatgaacgaactcgtc
gagaaggcccgcgaacgctcgatcgcacccgacgaactgcagggatcgacgttcacgatc
accaacatcggcggcatcggtggcgagtacgcgacgccgatcctgaactaccccgagtcg
ggcatcctcgcagtcggcgagatcaagcgcaagccccgcgtcatcgagacagacggcgag
gaacggatcgaaccgcgttccgtgatgacactgtcgctatccttcgaccaccggctgatc
gacggtgccgtcggcgcacagtttacgaacaaggtactcgagtacctcgagaacccgaac
ctactactgctggagtaa

DBGET integrated database retrieval system