KEGG   Natronobacterium gregoryi: Natgr_1689Help
Entry
Natgr_1689        CDS       T02383                                 

Definition
phosphoglucosamine mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nge  Natronobacterium gregoryi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natgr_1689
   00030 Pentose phosphate pathway
    Natgr_1689
   00051 Fructose and mannose metabolism
    Natgr_1689
   00052 Galactose metabolism
    Natgr_1689
   00500 Starch and sucrose metabolism
    Natgr_1689
   00520 Amino sugar and nucleotide sugar metabolism
    Natgr_1689
  Nucleotide metabolism
   00230 Purine metabolism
    Natgr_1689
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Natgr_1689
Enzymes [BR:nge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Natgr_1689
    5.4.2.8  phosphomannomutase
     Natgr_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1674887..1676251
Genome map
AA seq 454 aa AA seqDB search
MEVFGSSGTRGVANDELTPAFVLRVAKAAGTAWGVDRVAIARDTRYTGRMLADAAASGLA
STGTDVDRLGVVPTPGAQFYAEREAIPVIVVTASHNPPQYNGIKLVGSDGVELAVSDLER
IEEALLAEAYTVAPWDGTGRVREVEGVTDDYVDALLEAVDRETIADAELTVALDPGHGAG
SLTSPGFFRELGCRVVTVNSQPDGHFPGRDPEPVPENLAELGRLVRATDADVGIAHDGDA
DRAIFFDENGEYVEGDATLAALAAAELEAGDTTVSAVNVSQRLVDVVDDVGAELELTPIG
STNIITRIEELEAKDSRVPIAGEGNGGIFFPGYRLSRDGAFTAARFLELVAERPVSEIVA
PYGGYANVRRNIEYESTAERDAMLDAAANHAHAADADLNTRDGYRLDYGDAWVLARPSGT
EPLVRIYAEARDAGRANDLAEGMYKTLLEAKADA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgttcggatccagtgggacacgcggcgtcgccaacgacgaactgacgcccgcg
ttcgtcctgcgcgtcgcgaaagcggcggggacggcctggggggtcgatcgggttgccatc
gcgcgtgacacgcgctacaccggccgaatgctcgccgacgcggccgcgagcgggctggcg
agtacgggaaccgatgtcgaccgcctcggagtcgtccccaccccgggggcacagttctac
gccgaacgcgaagcgattccagtaatcgtcgtcacggcctcgcacaatccgccacagtac
aacgggatcaaactcgtcggcagcgacggcgtcgaactcgccgtctccgacttagagcga
atcgaagaggcgctgctcgcggaggcctacaccgtcgcaccgtgggacgggacgggacgc
gtccgtgaggtcgagggcgtcaccgacgactacgtcgacgccctgctcgaggcagtcgac
cgggagacgatcgccgacgccgagttgacggtcgcactcgatcccggccacggcgcgggc
tcgcttaccagtcccggcttcttccgggaactgggctgtcgcgtcgtcacggtcaacagc
cagcccgacggtcacttccccggccgagaccccgagccagttcccgagaacctcgcggaa
ctgggacgactcgtccgagcgaccgacgccgacgtcggcatcgcccacgacggcgacgcc
gaccgcgcgatcttcttcgacgagaacggcgagtacgtcgagggcgacgccacactcgcc
gcccttgcggccgcagaactcgaggccggcgacacaaccgtctcggcggtcaacgtctcc
cagcggctcgtcgacgtcgtcgacgacgttggcgcggaactcgagttgacgccgatcggc
tcgacgaacatcatcacccgaatcgaggaactcgaggcgaaagacagccgcgttccaatc
gcaggtgagggcaacggcgggatcttcttccccggctatcggctctcgcgggacggtgcg
tttacggctgcacggtttctcgaactcgtcgccgagcgaccggtcagcgagatcgtcgcg
ccctacggcggctacgccaacgttcggcgcaacatcgagtacgagtcgaccgccgaacgc
gacgcgatgctcgatgcggcggccaaccacgcgcacgctgccgacgccgacctaaacacg
cgagacggctaccgactcgactacggcgacgcgtgggtgctcgcccgcccctcggggacg
gagccgctcgtccgaatctacgccgaggcccgcgacgccggccgtgcgaacgaccttgcc
gaagggatgtacaaaaccctgctcgaggcgaaagccgacgcttaa

DBGET integrated database retrieval system