KEGG   Natronobacterium gregoryi: Natgr_1689Help
Entry
Natgr_1689        CDS       T02383                                 

Definition
(GenBank) phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nge  Natronobacterium gregoryi
Pathway
nge00010  Glycolysis / Gluconeogenesis
nge00030  Pentose phosphate pathway
nge00051  Fructose and mannose metabolism
nge00052  Galactose metabolism
nge00230  Purine metabolism
nge00500  Starch and sucrose metabolism
nge00520  Amino sugar and nucleotide sugar metabolism
nge00521  Streptomycin biosynthesis
nge01100  Metabolic pathways
nge01110  Biosynthesis of secondary metabolites
nge01120  Microbial metabolism in diverse environments
nge01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natgr_1689
   00030 Pentose phosphate pathway
    Natgr_1689
   00051 Fructose and mannose metabolism
    Natgr_1689
   00052 Galactose metabolism
    Natgr_1689
   00500 Starch and sucrose metabolism
    Natgr_1689
   00520 Amino sugar and nucleotide sugar metabolism
    Natgr_1689
  Nucleotide metabolism
   00230 Purine metabolism
    Natgr_1689
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Natgr_1689
Enzymes [BR:nge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Natgr_1689
    5.4.2.8  phosphomannomutase
     Natgr_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFZ72887
UniProt: L0AI83
Position
1674887..1676251
Genome map
AA seq 454 aa AA seqDB search
MEVFGSSGTRGVANDELTPAFVLRVAKAAGTAWGVDRVAIARDTRYTGRMLADAAASGLA
STGTDVDRLGVVPTPGAQFYAEREAIPVIVVTASHNPPQYNGIKLVGSDGVELAVSDLER
IEEALLAEAYTVAPWDGTGRVREVEGVTDDYVDALLEAVDRETIADAELTVALDPGHGAG
SLTSPGFFRELGCRVVTVNSQPDGHFPGRDPEPVPENLAELGRLVRATDADVGIAHDGDA
DRAIFFDENGEYVEGDATLAALAAAELEAGDTTVSAVNVSQRLVDVVDDVGAELELTPIG
STNIITRIEELEAKDSRVPIAGEGNGGIFFPGYRLSRDGAFTAARFLELVAERPVSEIVA
PYGGYANVRRNIEYESTAERDAMLDAAANHAHAADADLNTRDGYRLDYGDAWVLARPSGT
EPLVRIYAEARDAGRANDLAEGMYKTLLEAKADA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgttcggatccagtgggacacgcggcgtcgccaacgacgaactgacgcccgcg
ttcgtcctgcgcgtcgcgaaagcggcggggacggcctggggggtcgatcgggttgccatc
gcgcgtgacacgcgctacaccggccgaatgctcgccgacgcggccgcgagcgggctggcg
agtacgggaaccgatgtcgaccgcctcggagtcgtccccaccccgggggcacagttctac
gccgaacgcgaagcgattccagtaatcgtcgtcacggcctcgcacaatccgccacagtac
aacgggatcaaactcgtcggcagcgacggcgtcgaactcgccgtctccgacttagagcga
atcgaagaggcgctgctcgcggaggcctacaccgtcgcaccgtgggacgggacgggacgc
gtccgtgaggtcgagggcgtcaccgacgactacgtcgacgccctgctcgaggcagtcgac
cgggagacgatcgccgacgccgagttgacggtcgcactcgatcccggccacggcgcgggc
tcgcttaccagtcccggcttcttccgggaactgggctgtcgcgtcgtcacggtcaacagc
cagcccgacggtcacttccccggccgagaccccgagccagttcccgagaacctcgcggaa
ctgggacgactcgtccgagcgaccgacgccgacgtcggcatcgcccacgacggcgacgcc
gaccgcgcgatcttcttcgacgagaacggcgagtacgtcgagggcgacgccacactcgcc
gcccttgcggccgcagaactcgaggccggcgacacaaccgtctcggcggtcaacgtctcc
cagcggctcgtcgacgtcgtcgacgacgttggcgcggaactcgagttgacgccgatcggc
tcgacgaacatcatcacccgaatcgaggaactcgaggcgaaagacagccgcgttccaatc
gcaggtgagggcaacggcgggatcttcttccccggctatcggctctcgcgggacggtgcg
tttacggctgcacggtttctcgaactcgtcgccgagcgaccggtcagcgagatcgtcgcg
ccctacggcggctacgccaacgttcggcgcaacatcgagtacgagtcgaccgccgaacgc
gacgcgatgctcgatgcggcggccaaccacgcgcacgctgccgacgccgacctaaacacg
cgagacggctaccgactcgactacggcgacgcgtgggtgctcgcccgcccctcggggacg
gagccgctcgtccgaatctacgccgaggcccgcgacgccggccgtgcgaacgaccttgcc
gaagggatgtacaaaaccctgctcgaggcgaaagccgacgcttaa

DBGET integrated database retrieval system