KEGG   Natronobacterium gregoryi: Natgr_1998Help
Entry
Natgr_1998        CDS       T02383                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nge  Natronobacterium gregoryi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Natgr_1998
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Natgr_1998
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Natgr_1998
Enzymes [BR:nge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Natgr_1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1959929..1961062
Genome map
AA seq 377 aa AA seqDB search
MASDLVCPACGTTYEAGPSEPWRCGCERALEFVEQPLPTGDPLAASQLDSSDGLWAFSEF
LPIEQRVTFHEGFTPLVDAPDWDAQFKLEYVFPTGSFKDRGATTTLSRAAELGVEKVIED
SSGNAGAAIATYAARAGLDADIYVPADVKQSKLMTIQQADARPIRIEGSRQDVTDACIDA
VAGEADDSNDGAPSQTGEGWYASHAWNPAFYAGTMTFAFEVAAQRAWTAPDAVVLPLGHG
TLFLGSYLGFSRLSEAGIVDELPRLLGAQAEGYAPIVEALGGNGGLEQTDVADGIQITEP
ARMDDVLAAIDGTDGDAIALDDDEIEATLDRLHRNGFYVEPTSAVAPAALDRYRETGVLE
GDDDVVVPLTGSGLKAL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgatctcgtctgccccgcctgcgggaccacctacgaggccgggccatccgaa
ccgtggcgctgtggctgtgagcgcgccctcgagttcgtcgagcagccgcttccgacgggc
gatccgctggcggcctcccagctagactccagcgacgggctctgggcgttctccgagttc
ctgccgatcgagcaacgcgtcaccttccacgaaggtttcacgcccctcgtagacgctccc
gactgggacgcccagttcaaactcgagtacgtcttcccgaccggctcgttcaaggatcgg
ggcgcgacgacgacgctctcgcgggcggccgaactcggcgtcgagaaagtcatcgaggac
tcctcgggtaacgccggcgcggcgattgcgacctacgccgcgcgagcggggctcgacgcc
gacatctacgtgccggcggacgtcaaacagtcgaaactgatgacgatccagcaggccgac
gcgcgcccgatccggatcgaggggagtcgccaggatgtcaccgacgcctgcatcgacgcg
gttgcaggtgaggccgacgactcgaacgacggggctccgtcccagacgggcgaggggtgg
tacgccagtcatgcctggaaccccgccttctacgctgggacgatgacgttcgctttcgag
gtcgccgcccagcgagcgtggaccgcaccggacgccgtcgtgcttccgctcggacacggg
acgctgtttctcggctcgtacctcggattcagtcgactgtccgaggccggaatcgtcgac
gagttgccccgcctgctcggtgcacaggcggagggctatgcccccatcgtcgaggcactc
ggcggcaacggcggcctcgagcagaccgacgtcgcagacggcatccagatcaccgaaccc
gcccgcatggacgacgttctcgcggcgatcgacggaacagacggcgacgccatcgcgctc
gacgacgacgagatcgaggccacgctcgatcgtctccaccgtaacggcttctacgtcgag
ccgacgagtgcggtcgctccggcggcgctggatcgatatcgcgagaccggtgtactcgag
ggcgacgacgacgttgtcgtcccgctgaccggcagcggactgaaagccctttga

DBGET integrated database retrieval system