KEGG   Natronobacterium gregoryi: Natgr_2082Help
Entry
Natgr_2082        CDS       T02383                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nge  Natronobacterium gregoryi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Natgr_2082
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Natgr_2082
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Natgr_2082
Enzymes [BR:nge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Natgr_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2031107..2032300
Genome map
AA seq 397 aa AA seqDB search
METTAAFTGLECVDCGTTFDAAEETHRCPGCGGILDPTYQYDAIDLDRETLESRPFDSMW
RYEELLPFSRESATTMDEGATPLVDCPALADDLGVGRVLIKDEGRNPTGTFKDRGQTVAV
TAATKHGASDVVLASAGNAGQAASAYAGRAGLDSHVYLPSRSGFTNKAMVNVHGGDMNVV
GGRIGDAGTAYVEAREENDDWFPLQTFVTPYRHEGKKTMFYEIVEQLDWEVPDAITYPTG
GGVGLIGMYKAATEFRDLGLIDELPGLYAAQASGCAPIVEAFEEGRDEHDPVETPDTICG
GLEIPDPGASPWVLEALCETDGGAVSTDDPDILQAGVQVAKQEGLEMCPSSAAAASGAWE
LAERGEFGNDDTVVILNTGAGNKEADVLRSHLMSQGV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagacgacagccgccttcaccggcctcgagtgcgtcgactgcgggacgacgttcgac
gccgccgaagagacccaccggtgtccgggctgcggtggcattctcgatccgacctaccag
tacgacgcgatcgacctcgaccgcgagacgctcgagtcgcggccgttcgactcgatgtgg
cgctacgaggagttgctgccgttttcccgtgagtcggcgaccacgatggacgagggagcg
acgccgctcgtcgactgtcccgccctggccgacgacctcggcgtcggacgcgtgctgatc
aaagacgagggacgcaatccgacggggacgttcaaggaccgcggacagacggtcgcggtg
acggcggcgacaaagcacggcgcgagcgacgtcgtcctcgcctcggctggcaacgctgga
caggcggcttccgcctacgcaggccgtgcagggctcgattcgcacgtctatctcccctcg
cggtctggctttacgaacaaggcgatggtcaacgtccacggtggcgacatgaacgtcgtc
ggcggacggatcggcgacgcgggcacagcctacgtggaagcccgcgaggagaacgacgac
tggttccccctgcagaccttcgtcaccccctaccgccacgaggggaagaagacgatgttc
tacgaaatcgtcgaacaactggactgggaggtccccgacgcgatcacctacccgaccggc
ggcggcgtcggcctgatcgggatgtacaaggccgcaacggagttccgtgacctcggcctg
atcgacgaactgccgggactgtacgcagcgcaagcctcgggctgtgcgcccatcgtggag
gcattcgaggaaggacgagacgagcacgaccccgtcgagacccccgacaccatctgtggc
ggcctcgagattcccgacccaggtgccagtccgtgggtcctcgaggcgctgtgcgagacc
gacggcggcgcggtctcgacggacgatccggacattctgcaagcgggcgttcaggtggcc
aaacaggaagggctcgagatgtgtcccagttcggcggctgcggcgagtggcgcgtgggaa
cttgcggaacgcggcgagttcggcaacgacgatacggtcgtcattctcaataccggtgcg
ggcaacaaggaggcggacgtgttacggagtcacctgatgagccagggtgtctga

DBGET integrated database retrieval system