KEGG   Natronobacterium gregoryi: Natgr_2713Help
Entry
Natgr_2713        CDS       T02383                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
nge  Natronobacterium gregoryi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2642763..2644481
Genome map
AA seq 572 aa AA seqDB search
MSTETPDSDPTETEAFQQVCETLVERILAGEIERDEVETAKLEACSEHSAPKVPKNSELL
DYAPKEHREDLESVLQRKPVRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFSSSQSY
TGEEPAAARGVQNDYDPYGQVRLRLEQLREIGHPVDKVELILMGGTMTARSHDYQEWFVK
RALEAMNDFDVDKEPEPAEGVSFAQDPEEYEWTYLEDVIAENERGDIRNIGTTFETKPDW
CDPEQVDRMLDLGGTKVEVGVQTTYERINREMHRGHGVAESIDANQRLRDAAFKVGFHMM
PGQPGMSKEMCLEDFRRLFEQEQWKPDYLKIYPTLIVRGTATYDWWHKGEFEPLGNEEAA
ELIAEIKEMIPRYTRLQRVQRDIPADFIDAGVWKSNLRQLARKRMDEHGWSCDCIRCREV
GMNDEEPENIELDVMEYEACGGTEHFISFEDFEKDLLVGFCRLRFPSGEASKARRSSSDE
SDADPVRPELENAALVRELHVYGSEVAMGDEGDGDQHQHQGYGRRLMNQAEELAADAGYD
KVSVISGIGAREYYREKLGYYQDGPYVSKRLR
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgagacgcccgattccgatccgacggaaaccgaagcgttccagcaggtctgt
gagacgctcgtcgaacggatcctcgcgggcgagatcgaacgcgacgaggtcgagacggcc
aaactcgaggcctgttcggaacattcggcccccaaggtgccgaaaaactccgaactgctg
gattacgcgcccaaagagcaccgcgaggacttagagtcggtgctccagcgcaaaccggtc
cgcaccgcgtcgggagtctcgccggtcgcgattatgacttcacccgagcggtgtccacac
gggaagtgtctctactgtcctggtggcccggactctgagttttcctcctcgcagagctac
actggcgaggaacccgcagcggcccgtggcgtccagaacgactacgacccctacgggcag
gttcggttgcgactcgagcaactccgagagatcgggcaccccgtggacaaggtcgagctc
atcctgatgggtgggacgatgactgcccgctctcacgactaccaggagtggttcgtcaag
cgcgccctcgaggcgatgaacgacttcgatgtcgacaaggagccggaaccagccgagggc
gtcagcttcgcccaggaccccgaggagtacgagtggacgtacctagaggacgtcatcgcg
gagaacgaacgcggcgacattcgaaatatcgggacgacgttcgagaccaagcccgactgg
tgcgatccggagcaggtcgaccggatgcttgacctgggcgggacgaaagttgaggtcggt
gtccagacgacctacgagcggatcaaccgcgagatgcatcggggtcacggcgtcgcagaa
tcgatcgacgccaaccagcgactgcgagacgcggcgttcaaggtcggcttccacatgatg
cccggccagccgggaatgagcaaggaaatgtgtctcgaggacttccgccgactgttcgag
caagagcagtggaaacccgactacctgaagatctatccgacgctgatcgtccgtggcact
gcgacctacgactggtggcacaaaggcgagttcgaaccgctgggcaacgaggaggccgcc
gaactgatcgccgagatcaaggagatgattcctcgctacacgcgacttcagcgcgttcag
cgggacattcccgcggactttatcgatgccggcgtctggaagtcgaacctccgacaactc
gcccgaaagcggatggacgaacacggctggtcgtgtgactgcatccgctgtcgtgaggtc
ggcatgaacgacgaggagcccgagaatatcgaactcgacgtcatggagtacgaggcctgt
ggcgggacggaacacttcatctcgttcgaggacttcgagaaggacctcctggtcgggttc
tgtcggctgcggttcccgagtggtgaggcgagcaaagcgaggcgatcctcgtcggacgag
tccgacgcagacccggtccggccggaactcgagaacgccgcactcgtccgggaactgcac
gtctacggctcggaggtcgcgatgggcgacgagggtgacggcgaccagcaccagcaccag
ggctatggccgtcgcctgatgaaccaagccgaggaactcgccgccgacgccggctacgac
aaggtgagcgtgatttcgggcatcggcgctcgagagtactaccgcgagaagttggggtac
taccaggatgggccgtacgtgagcaaacggctccggtga

DBGET integrated database retrieval system