KEGG   Natronobacterium gregoryi: Natgr_2971Help
Entry
Natgr_2971        CDS       T02383                                 

Definition
nucleoside-diphosphate-sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
nge  Natronobacterium gregoryi
Brite
Enzymes [BR:nge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Natgr_2971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2903415..2904389
Genome map
AA seq 324 aa AA seqDB search
MTKTAAVTGATGFLGTHLCERLLEDGWDVRGLSRPNSDRGRLAPRDVEWHVGDLFDEPTL
RSLVDGADAVFHLAGIGLWNADPDAVERVNRDGTANVVSACRGATVGRLVFTSTAGTRRP
PEEGVVADETDVAEPIGAYQKGKAAAEELVDRYAADGGDAVTVHPTSVFGPGDDSFTAQL
LTMGLERTMPAHLPGGLSIVGVDDVVDGLVLAYEEGEPGEHYILGGENLTYEQAVSRIAS
HADGSPARIQVPATAIHAAGPVAETVGAVTNRHVFPFSRGMARLATSRLFYSSRKAHEEL
GYEYEPLEAHLPETLEWYRTTVRG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagacagctgccgtcaccggcgcgacgggctttctcggaacgcatctctgcgag
cgactgctcgaggacggctgggacgtacgcggattgagccgccctaattcggatcggggg
cggctcgcgccgagagacgtcgagtggcacgtcggtgatctcttcgacgagccgacgctt
cgctcgctcgtcgacggcgcggacgcggtctttcacctcgcgggcatcggtctctggaac
gccgaccccgacgcggtcgagcgagtcaaccgcgacgggacggcaaacgtcgtctcagcc
tgccgtggcgctaccgtcggtcgcctcgtgttcactagtacggcggggaccagacgcccg
ccagaggagggtgtggtcgcggacgaaaccgacgtcgcggaaccgatcggtgcctaccag
aagggaaaagccgccgcagaagaactggtcgatcgctacgcggccgacggtggtgacgcc
gtgactgtccacccgacgtccgtcttcggtcccggtgacgactcctttacggcgcagttg
ctgacgatgggactcgagcggacgatgccggcccacctcccgggcggactcagcatcgtc
ggcgtcgacgacgtggtcgacgggctggtgctcgcctacgaggagggcgagcctggcgaa
cactacattctgggcggagagaatctcacctacgagcaggcggtttcgcggatcgcgtcc
cacgccgacggctctcccgcccgaatccaggtgccggccacggcgatccacgcggcgggt
cccgtcgccgagaccgtcggcgcggtgacgaaccgccacgtcttcccgttcagtcgcggg
atggcccggctggcgaccagtcggctcttctactcctcgcggaaagcccacgaagaactc
ggctacgagtacgaacccctagaagcgcacctgccggagaccctcgagtggtaccggacg
accgtccgggggtag

DBGET integrated database retrieval system