KEGG   Natronobacterium gregoryi: Natgr_3041Help
Entry
Natgr_3041        CDS       T02383                                 

Definition
acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nge  Natronobacterium gregoryi
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nge01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nge00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2979288..2980529
Genome map
AA seq 413 aa AA seqDB search
MTTTLASLVRERHAELAETTLELVGHETTNPPGDTREVVAWLESQFTDFGIETERVVANP
EKPNLLATVAGERDRTLLFAGHLDTVPYDADGWSYDPLGERVGDQLYGRGTSDMKGALAA
MLAVARAAAESETSPPVTLSFAFVSDEEVAGEAGLPAVLKDGRLAADACVIGEPTCDDER
ASLTVADRGSIWLTFEATGKAAHGSRPMLGENAIDRLWRALEDVRTRLEDRTLSIPPTVE
PVLEESVDYYAQAMGADTARRLFDRPTVNLGTLEGGKAVNSVPREARARLDVRLAPGVET
PAVLASIRDWLETHRAVSIADVSYSVGSYEDLAEPIVDATHAVASDILEDRVYRRSATGG
GDAKQFRNADVPTVEFAVATNTAHACDEYTTVDALAETAEVYARLPEAFASAV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacactcgcgtctctcgtccgagagcgccacgccgaactcgccgagaccact
ctcgaactcgtcgggcacgaaacgacgaacccgcctggcgatacacgcgaggtcgtcgcc
tggctcgagtcacagtttactgacttcgggatcgagaccgaacgagtcgtggccaatccg
gagaaaccgaaccttctcgcgacggtcgccggcgagcgcgatcggacgctgcttttcgcc
ggccacctcgataccgtcccctacgacgccgacggctggtcgtacgacccgctcggcgaa
cgtgtcggcgaccaactctacggccgtgggacgagcgacatgaagggggcgctcgccgct
atgctcgcggtcgctcgcgccgccgccgagtccgagacgtcgccgccggtgacgctctcg
tttgccttcgtcagcgacgaggaggtcgccggcgaggcgggactgcccgccgtcctcaag
gacggacggctcgcggccgacgcatgcgtgatcggtgagccgacctgcgacgacgagcga
gcgtcgctcacggtcgccgacaggggaagcatctggctcacgttcgaggcgaccggcaaa
gccgctcacggctcgcgaccgatgctcggcgagaacgcgatcgatcggctctggcgtgca
ctcgaggacgtccggacccgtctcgaagaccgtacactgtcgatcccgccgaccgtcgag
cccgtcctcgaggagtcggtcgactactacgcgcaagcaatgggggccgacacagcacgg
cgactgttcgatcgaccgacggtcaacctgggaacgctcgagggtggcaaagccgtaaac
agcgtcccgcgcgaggcacgcgctcgactcgacgttcgactcgcgccgggcgtcgaaacg
cctgcagtactcgcgtcgatccgcgactggctcgagactcaccgagcggtctcgatcgcg
gacgtcagctacagcgtcgggagctacgaggacctcgcggagccgatcgtcgacgcaacc
cacgccgtcgccagcgacatcctcgaagaccgagtttaccgccggagcgcgaccggtggc
ggcgacgcgaaacagtttcgcaacgccgatgttccgaccgtcgagttcgccgtcgcgacg
aacacggcccacgcctgtgacgagtacacgacggtcgacgctctcgccgagacagccgag
gtgtacgcgcggttgccggaggcgttcgcgtcggcggtatga

DBGET integrated database retrieval system