KEGG   Natronobacterium gregoryi: Natgr_3126Help
Entry
Natgr_3126        CDS       T02383                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nge  Natronobacterium gregoryi
Brite
Enzymes [BR:nge01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Natgr_3126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3065747..3067093
Genome map
AA seq 448 aa AA seqDB search
MGYSRQLLLVVAVSLLAVVSAGAVAAADASEAHSAEPVMEGDVAPQVQENNETEELPVEP
PTEESHPGYEYIRQEGDTEEKIELGEQLYFDPRISETGTISCNTCHNVMEGGDDSRPVAM
GVHGETGPVASPTVWNSGFHHTQFWDGRADTLAEQAEGPIVADVEMGMPDHEAALDRVRA
VDGYIEQYEEVYGDEVDSDDPEDLVTLDHTTDAIAAYERTLVTPNSPYDQYVEGDTDALT
DEQLDGMESFQELGCQSCHSGPMFSGQWDEPESGEGIYMPHPTFEENPQCEQYIEEYDLM
ENPGRAGVTDDEADEYHYKVPTLRNVEHTAPYMHTGQVPTLEEAIRVMGACSLDDEPSDE
EVEDIAAFLTTLTGEYPEQEMPRLPNPSGESMIPMDADAEFEDIEEERDDADETDDDGIP
GMTIGAAVLALAIATAATLVGYSRRLNG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggggtatagccgacagttgctactggtcgtcgccgtcagcctccttgccgtcgttagc
gcgggggctgtggctgcggccgacgcttcagaggcgcacagtgctgagccggtgatggag
ggtgacgtcgccccacaggttcaggagaacaacgaaacggaggagctaccggtagagcca
ccgaccgaggagtcacacccgggctacgagtacattcgacaggagggtgacaccgaagag
aagatcgaactcggcgaacagctgtacttcgacccgcgaatctccgagacgggaaccatt
tcgtgtaacacctgtcacaacgtgatggaaggcggtgacgacagccgtccggtcgcgatg
ggtgtccacggcgagactggaccggtcgcgtcgccgaccgtctggaactccgggttccac
cacacgcagttctgggacggccgcgccgacacgctggccgaacaggccgaaggaccgatc
gtcgccgacgtcgagatgggtatgcccgaccacgaggcagccctcgatcgcgtccgcgca
gtcgatggttacatcgagcagtacgaggaggtctacggcgacgaagtcgacagtgacgac
cctgaagacctcgtgactctcgatcacacgaccgacgcgatcgccgcctacgagcgaacg
ctcgtgacgccgaacagtccctacgaccagtacgtcgagggtgacaccgacgcgttgacc
gacgagcaactcgacggcatggagtcgttccaggaattgggctgtcagagctgtcactcc
gggccgatgttcagcggccagtgggacgaacccgagtccggtgagggcatctacatgccg
catccgacgttcgaagagaacccacagtgtgagcagtacatcgaggagtacgacctgatg
gagaacccgggccgtgcgggcgtcactgacgacgaggcagacgagtaccactacaaggta
ccgacgttgcgcaacgtcgagcacaccgccccgtacatgcacaccgggcaggtgccaacc
ctcgaggaagccatccgcgtgatgggggcctgtagcctcgacgacgagccgtccgacgag
gaagtcgaggacatcgcggctttcctgacgactctgactggggagtacccggaacaggag
atgccgcgactgccgaacccgagcggcgaatcgatgatcccgatggacgctgacgcggaa
ttcgaggacatcgaggaagaacgtgacgacgccgacgaaactgacgacgacggcattccc
ggaatgacgatcggcgcagcagtcctcgcgctggcgatcgcgactgctgcaacactggtc
ggctactctcgacggctaaacggctag

DBGET integrated database retrieval system