KEGG   Natronobacterium gregoryi: Natgr_3213Help
Entry
Natgr_3213        CDS       T02383                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nge  Natronobacterium gregoryi
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Natgr_3213
Enzymes [BR:nge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Natgr_3213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3154656..3155507
Genome map
AA seq 283 aa AA seqDB search
MFPGATDERGGSNAGVAREDANFVVVGAPLDATTTFQPGTRFGPRRIRTFAETFDDYDRR
TDQYFSELDVVDHGDVRAWDDVPDYLEWLEGTLRDIVWDDAVPLLLGGEHTVSLAGVRAA
DPEVFVCLDAHLDLRDDYDGNDLSHACVTRRILEDESVEEAIILGARTGSEPEWERAAED
DVTVVAPADVADFTFGDRLEGREVYLSVDIDGADPAYAPGTGTTEPFGLEPREMRAVVRE
VAPQATAFDVVEVNDRDDGQAASLAGKLLREFVYSSGADSSSA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttccccggggcaactgacgaacgcggggggagcaacgccggtgtggcccgcgaggac
gcgaacttcgtggtcgtcggtgcgcccctggacgccacgacgacctttcagccggggact
cgctttggcccccggcgcatccggacgtttgcggagaccttcgacgattacgaccgtcga
acggaccagtacttctccgaactcgacgtcgtcgatcacggcgacgttcgggcctgggac
gacgttcccgactacctcgagtggctcgaggggacgctgcgcgatatcgtttgggacgat
gccgtccctctccttttggggggcgaacacacagtctcgcttgcgggcgtacgcgccgcc
gaccccgaggtgttcgtctgtctcgacgcccacctcgacctgcgcgacgactacgacggc
aacgacctctctcatgcctgcgtaacccgtcgcattctcgaggacgaatcggtcgaggaa
gcgattatcctgggtgcgagaacgggcagcgagccggagtgggagcgagcggccgaagac
gacgtcaccgtcgttgcgcccgcggatgtcgccgattttaccttcggcgaccgtctcgag
ggacgcgaagtctacctgagtgtcgacatcgacggggctgacccagcctacgcgcccggt
accgggacgacggagccgttcggcctcgaaccccgtgagatgcgggcggtcgtccgcgag
gtcgccccacaggcgacggccttcgacgtcgtcgaagtcaacgaccgcgacgacggccag
gccgcctcgctcgcgggaaaactcctccgagagttcgtctactcgagtggagccgactcg
tcttccgcctaa

DBGET integrated database retrieval system