KEGG   Natronobacterium gregoryi: Natgr_3612Help
Entry
Natgr_3612        CDS       T02383                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nge  Natronobacterium gregoryi
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nge00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3556135..3557250
Genome map
AA seq 371 aa AA seqDB search
MTTLRGAAPKTVRDALERTDPLPGTAGFAGEIDGRLVRDVLGREPLFYESADAPDRWAFE
PAVLEEPVALPAGSTLELAALEDETSDPRIQQHWTLPDPEPDPDHDAALEALEMAIRTAV
DEVQADLEVAVAFSGGVDSALVAELLDAPLYVVGFPDSHDVEAARTAAEAMGRELTVVEL
EPADLERAVPEIARATGRTNAMDVQIALPLYLVGERVAADGFDALAVGQGADELFGGYEK
VVRLDHRVEAETIRGAVRESILSLPEQLPRDVLTSRATGLEPVAPLLHDAVVDAALRLPD
ELLADEQLRKRGFRRVAARQLPEAVADRDKKAVQYGSLVARELDRLARQAGYKRRMDDHV
SKYISSLLETG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcttcgcggtgccgccccaaagacggttcgtgacgccctcgagcggacggac
ccgctcccgggaacggccggcttcgcgggcgaaatcgacgggcgactcgttcgtgacgtg
ctcggccgcgagccgctcttttatgagagcgcggacgcgcccgatcgctgggcgttcgaa
cccgccgtgctcgaggagccagtggcgttaccggcagggtcgacgctcgagctggcggcc
ctcgaggacgagacgagtgacccgcgaatccagcaacactggacgctgcccgaccccgag
cccgatccggaccacgacgccgcactcgaggcgctcgagatggcgatccggacggccgtc
gacgaggtccaggcggatctcgaggtcgccgttgctttctccggcggcgtcgactctgcg
ctggttgccgagttactcgacgcgccgctgtacgtcgtcgggtttccggacagccacgac
gtcgaggccgcccgcaccgccgcggaggcgatgggtcgagagctgacggtcgtcgaactc
gagcccgcagacctcgagcgtgctgttcccgagattgcacgggcgacgggccggacgaac
gcgatggatgtccagatcgccctgccgctgtacctggtgggcgaacgcgtcgctgccgac
gggttcgacgcgctcgcggtcggacagggagcggacgaactgttcggcggctacgagaag
gtcgtccggctggaccaccgtgtcgaggccgagacgatccgcggtgccgtccgcgagagt
atcctgagtctgccagagcaactcccgcgagacgtactgacgagcagggcgacggggctc
gagccggtcgcgccgcttctccacgacgccgtcgtcgacgcggcgctgcgactgccggac
gagttgctcgcagacgagcagctccggaagcgtggctttcggcgcgttgccgcccggcag
ttgcccgaggcagtcgcggaccgcgacaagaaggccgtccagtacggcagcctcgtcgcc
cgcgaactcgatcgactcgcccgccaggcaggctacaagcgtcggatggacgaccacgtc
tcgaaatatatctcgtcgctgctcgagaccgggtga

DBGET integrated database retrieval system