KEGG   Natronobacterium gregoryi: Natgr_3688Help
Entry
Natgr_3688        CDS       T02383                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nge  Natronobacterium gregoryi
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natgr_3688
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Natgr_3688
   00640 Propanoate metabolism
    Natgr_3688
   00660 C5-Branched dibasic acid metabolism
    Natgr_3688
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Natgr_3688
Enzymes [BR:nge01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Natgr_3688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3640090..3641247)
Genome map
AA seq 385 aa AA seqDB search
MGMRLHEYQAKGVFADAGIPTPASQLASDVDGVVSAADEIGYPVAVKAQVHVGGRGKAGG
IELVADADEAREAADSILGMDLKGYHVEQVLVEEAVDFTNELYVGITMDRSEGKPVAMVS
TKGGVDIEGVAEEDPDAIAREHVDPSFGMHPYQARKAVYDAGVDESVARDVSSILKTLYD
LWESRDGSDVEINPLMVTEDDEVVAADAVMNVDEDALFRQPELAEMEDEAAGGDELEQKA
DEYDFDYVRLSGNVGIIGNGAGLVMTTLDLVDHYGGEPANFLDVGGGAKAQRIANALDMV
FSDDNVDSVVFNIFGGITRGDEVARGINEALEQFDEIPKPVVVRLAGTNWEEGMEILNED
LVTVEQTLEDAVQRSVEYADEVNEQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgagactacacgaatatcaggcgaagggggtctttgccgatgctggcattccg
acgccggcatcacaacttgcctccgacgtcgacggggtcgtttctgcggcggacgagatc
gggtatccagtcgcagtcaaagcgcaggtacacgtcggtgggcgtgggaaggccggtggg
atcgaactcgtcgcggacgccgacgaggctcgcgaggcagccgattcgattcttgggatg
gatctcaagggctatcacgtcgagcaggttctcgtcgaggaagccgtcgacttcaccaac
gaactctacgtcgggatcacgatggaccgcagcgagggcaagcccgttgcgatggtttcg
accaaaggtggggtcgatatagagggtgtcgccgaggaagatcccgacgcgatcgcacgc
gagcacgtcgatccgtctttcggcatgcatccctaccaggcccgcaaggccgtctacgac
gcgggcgtcgacgagtcggtcgcccgcgacgtctcgagtatcctgaaaacgctgtacgat
ctctgggagagccgtgacggctccgacgtcgagatcaacccgctgatggtcaccgaagac
gacgaggtcgtcgcggccgacgctgtgatgaacgtcgacgaggacgcactgttccgccag
cccgaactcgccgagatggaagacgaagccgccggcggggacgaactcgagcagaaggcc
gacgagtacgacttcgactacgttcgcctgtctggtaacgtcggcatcatcggcaacggc
gctgggctggtgatgacgacgctggatctcgtcgatcactacggcggcgaaccagccaac
ttcctggatgtcggcggtggcgcgaaagcccagcgtatcgcgaacgcgctcgatatggtt
ttttcggacgacaacgtcgactcggtcgtcttcaacatcttcggcggcatcactcgcggt
gacgaggtcgcccgcgggatcaacgaggcgctcgagcagttcgacgagattccaaagccg
gtcgtcgtccggcttgccggcacgaactgggaggaaggtatggagattctgaacgaggac
ctcgtgacggtcgaacagaccctcgaggacgcggttcagcgttccgtcgagtacgctgac
gaggtgaacgaacaatga

DBGET integrated database retrieval system