KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740533Help
Entry
103740533         CDS       T03372                                 

Gene name
Abhd6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:ngi00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    103740533 (Abhd6)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103740533 (Abhd6)
Peptidases [BR:ngi01002]
 Serine Peptidases
  Family S33
   103740533 (Abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGSTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVQHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLCLVCPAGLQYST
DNQFVQRLKELQESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADILAKSIATCQVEL
LENCGHSVVMERPRKTAKLILDFLASVHNTDNSKKLN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatctggatgtggttaacatgtttgtgattgccggcagcaccctggccattccaatc
ctggcattcgtcgcctcttttctcctgtggccatcggcgctaataagaatctactactgg
tactggcggaggacactgggcatgcaagtccgctatgtgcagcacgaggactatcagttc
tgttactccttccggggcaggccagggcacaagccgtccatcctcatgctccatggattc
tcagcacacaaggatatgtggctcagcgtggtcaagttccttccaaagaacctgcactta
gtctgtgtggacatgccaggccatgaaggcaccactcgatcttccctggatgacctgtcc
atagatgggcaagtcaaaaggatccatcagtttgtagaatgccttaagctgaacaaaaag
cccttccaccttataggcacctccatgggaggccatgtggctggcgtctatgctgcttat
tacccatcagatgtctgcagcctgtgtctggtgtgccctgctggcctgcagtattcaact
gataaccagtttgtacaacggctcaaagagctgcaggagtccgccgccatacagaaaatt
cccttgatcccatctaccccagaagagatgagtgaaatgctccagctctgttcctatgtc
cgtttcaaggtgccccaacagatcctgcaaggccttgtcgacgtccgcatccctcataac
aacttctatcggaaactatttttggaaattgtcagcgagaagtccagatactctctacat
cagaacatggacaagatcaaggtcccgacacagatcatttgggggaaacaagaccaggtg
cttgatgtgtctggggcagatatattggccaagtcaattgctacctgtcaggtagagctt
ctggaaaactgtgggcactcggtggtgatggagagaccacgaaagacagccaagctcatc
cttgactttttagcatctgtgcacaacacagacaacagtaagaagctgaactga

DBGET integrated database retrieval system