KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0023Help
Entry
NGK_0023          CDS       T00728                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NGK_0023 (tpiA)
   01230 Biosynthesis of amino acids
    NGK_0023 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGK_0023 (tpiA)
   00051 Fructose and mannose metabolism
    NGK_0023 (tpiA)
   00562 Inositol phosphate metabolism
    NGK_0023 (tpiA)
Enzymes [BR:ngk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NGK_0023 (tpiA)
Exosome [BR:ngk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NGK_0023 (tpiA)
  Exosomal proteins of bladder cancer cells
   NGK_0023 (tpiA)
  Exosomal proteins of melanoma cells
   NGK_0023 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(14437..15192)
Genome map
AA seq 251 aa AA seqDB search
MWDQKWVIGNWKMNGRLQNNNALMHRFRILPTAERVLIGLAAPTVYLLQLHNAMQIVLNN
RILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQRRKMENV
LNVGLIPLLCVGESLEERETGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGTGKVATV
EQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGASLSYDS
FTAIISAAQNA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtgggatcaaaaatgggtcatcggcaactggaaaatgaacggccggctccaaaacaac
aacgcactgatgcaccgcttccgcatcctccccaccgccgaacgcgtcctcatcggactc
gccgccccgaccgtttacctgctgcaactgcacaacgccatgcaaatcgtcttaaacaac
cgcatcctcacctgcgcccaagacgtgagccgcttccccgacaacggcgcgtacaccggc
gaagtgtccgccgaaatgctcgccgacaccggaacagacatcgtcctcatcggacactcc
gaacgcagcctctatttcggcgaaaaaaacgaaatccaacgccgcaaaatggaaaacgtc
ctcaacgtcggactcatcccattattgtgcgtcggcgaaagcctcgaagagcgcgaaacc
ggcaaagaacacgaagtcatcgcccatcagctttccatcctgcaagggctggataccaaa
aacatcgccgtcgcctacgaacccgtctgggcaatcggcacaggcaaagtcgccaccgtc
gaacagattgccgatatgcacgcattcatctacaaagaaatcttgtctttgtgcggaagc
gatgttaaaatccgcgtcctttacggcggaagtgtgaaagcggacaacgcggccgacatc
ttcgcagtaccttatgtggacggcgcactcgtcggcggcgcgtcattgtcgtacgactcc
tttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system