KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0026Help
Entry
NGK_0026          CDS       T00728                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Brite
Enzymes [BR:ngk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NGK_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15999..16655
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALEEIPRELFADESLQGLAYADMELPLANGHKM
LEPKIVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRVVSDDIDAERQKRAKAVLD
GLSLENIDYVQNNGLTELSAGAPFDAVYVGGAVTLVPEVLKEQLKDGGRMAVIVGRRPVQ
RALLITRRGDVFEEKVLFDTLVAHLDDKDAHPFDSFNF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcagatccgtccttgggatgta
ttggattttgacgtgttggacgctttggaggagattccgcgcgagcttttcgcggatgag
tctttgcagggtttggcgtatgcggatatggagctgccgcttgccaacggtcataagatg
ctcgagccgaaaatcgtggcgcggctggcgcagggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggttcgggctatgcgacggctctgttggcaaaactggctggc
cgtgtggtttcggacgacatcgatgccgaacggcaaaagcgcgccaaagcggttttggac
ggcttgtctttggaaaacatcgattatgtgcaaaataacgggttgaccgaactttccgca
ggtgcgccgtttgatgcggtttacgtcggcggcgcggtaacccttgtgcctgaagtgtta
aaggaacagttgaaggacggcgggcgtatggcggttattgtgggacgcaggccggtgcag
cgcgcgcttttgattacgcgcaggggcgatgtgtttgaagagaaggtgctgttcgatact
ttggtggcgcatttggacgacaaggatgcccatcctttcgacagttttaatttttga

DBGET integrated database retrieval system