KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0181Help
Entry
NGK_0181          CDS       T00728                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ngk00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ngk00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(143769..144854)
Genome map
AA seq 361 aa AA seqDB search
MTVPHIPRGPVMADIAAFRLTEEEKQRLLDPAIGGIILFRRNFQNIEQLKTLTAEIKALR
TPELIIAVDHEGGRVQRFIEGFTRLPAMSTLGEIWDSEGAETAETHAEHIGWVLATELSA
CGIDLSFTPVLDLDWGNCAVIGNRSFHRNPEAVARLALALQKGLAKGGMKSCGKHFPGHG
FVEGDSHLVLPEDGRSLDELEAADLAPFRIMSREGMAAVMPAHVVYPQVDTKPAGFSEIW
LKQILRRDIGFKGVIFSDDLTMEGACGAGGIKERARISFEAGCDIILVCNRPDLVDELRD
GFTIPDNQDLAGRWQYMENSLGHEAVQAVIQTTGFQAAQAFVAGLASPQDTAGGVKVGEA
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccccatattccgcgcggccccgtcatggcagacattgccgccttccgcctg
accgaagaagaaaaacaacgcctgctcgatcccgcaatcggcggcatcatcctcttccgc
cgcaacttccaaaacatcgaacaactcaaaacactcaccgccgaaatcaaagccctgcgc
acacccgaactcattatcgccgtcgatcacgaaggcggcagggtgcaacgtttcatcgaa
ggttttacccgcctgcccgcaatgagtacgctcggcgagatttgggacagtgaaggcgcg
gaaactgccgaaactcatgccgaacacatcggatgggttttggcaaccgagctttccgcc
tgcggcatcgatttgtccttcacgcccgtcttagatttggactggggaaactgcgccgtc
atcggcaaccgcagcttccaccgcaatcccgaagcggtcgcccgcctcgccctcgccctt
caaaaaggtttggcaaaaggcggtatgaaatcatgcggcaaacatttccccggacacgga
tttgtcgaaggggacagccatttggtgctacccgaagacgggcgcagcctcgacgaactc
gaagccgccgacctcgcccccttccgcattatgagccgcgaaggtatggcggcggtcatg
cccgcccacgtcgtttatccgcaagtggacacaaagcccgcagggttttccgaaatctgg
ctcaaacaaattttgcgccgcgatatcggattcaaaggcgtgattttttctgacgatttg
accatggagggcgcgtgcggggcaggcggcatcaaagaacgcgcccgcatttcctttgag
gcaggttgcgacatcatattggtctgcaaccgtcccgacttggtcgatgaattgcgcgac
ggtttcaccattcccgacaaccaggatttggccggacgttggcaatacatggaaaactcg
ctcggtcatgaggcggtacaagccgttatacagacaacgggtttccaagcggcgcaagcc
tttgttgccggccttgcctcgccgcaggacacggcgggcggcgtaaaagtcggagaggcc
ttttaa

DBGET integrated database retrieval system