KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0284Help
Entry
NGK_0284          CDS       T00728                                 

Definition
HolC protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NGK_0284
   00240 Pyrimidine metabolism
    NGK_0284
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NGK_0284
   03430 Mismatch repair
    NGK_0284
   03440 Homologous recombination
    NGK_0284
Enzymes [BR:ngk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NGK_0284
DNA replication proteins [BR:ngk03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NGK_0284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
230169..230669
Genome map
AA seq 166 aa AA seqDB search
MPQCRLKLFRRHHPVKCSNNMPKVTFYTHVDQIPLFTCRLIARAIRDGGRILVWSDSFGR
LQELDKMLWQYEAESFIPHEIWETEEAMPSDTSVLLACGGNLPRIPEGMAVLNLSDGFWN
TASVLPARVLEIVGNSLEDLADARERFTAYRRSGFAIEHHGMEGKA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgccacaatgccgtctgaagcttttcagacggcatcatcctgtcaaatgctcaaacaat
atgccgaaagttaccttttatacccatgttgaccaaatccccctttttacctgtcggttg
attgcgcgcgctatccgagacggcggcaggatactggtgtggtccgactcgttcgggcgg
cttcaggaattggacaaaatgctttggcaatacgaggccgagagttttattccgcacgaa
atttgggaaacggaagaagccatgccgtctgacacatccgtcctgcttgcctgcggcggc
aatctgccccgaattcccgaaggcatggccgttttgaacctgtccgacggtttttggaac
accgcttcggtcttgcccgcgcgcgttttggaaatcgtcggcaacagcctggaagatctc
gccgacgcgcgcgaacgctttaccgcctaccgccgaagcggttttgccatcgaacatcac
ggcatggagggcaaggcatga

DBGET integrated database retrieval system