KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0355Help
Entry
NGK_0355          CDS       T00728                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk00040  Pentose and glucuronate interconversions
ngk00052  Galactose metabolism
ngk00500  Starch and sucrose metabolism
ngk00520  Amino sugar and nucleotide sugar metabolism
ngk01100  Metabolic pathways
ngk01130  Biosynthesis of antibiotics
Module
ngk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NGK_0355
   00052 Galactose metabolism
    NGK_0355
   00500 Starch and sucrose metabolism
    NGK_0355
   00520 Amino sugar and nucleotide sugar metabolism
    NGK_0355
Enzymes [BR:ngk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NGK_0355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: ACF29048
UniProt: B4RJP5
Position
complement(293496..294365)
Genome map
AA seq 289 aa AA seqDB search
MKPIKKAVFPVAGMGTRFLPATKANPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRN
KRSIEDHFDKAYELETKLEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARA
AIGDEPFAVILADDLIDAPKGALKQMVEVYGRSGNSILGVETVEPSQTGSYGIVETEQLK
QFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPRGAGNEIQLTDGIAKLLDH
EFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRRLLEKYRTE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgataaaaaaagccgtcttccccgttgcagggatgggaacccgcttcctgccc
gccaccaaggccaacccgaaagaaatgctgcccatcgtcgacaagccgctgatccaatac
gccgtagaagaagccgtggaagccggctgcacggaaatggtgtttgttaccgggcgcaac
aagcgcagcatcgaagaccatttcgacaaggcatacgaactcgaaactaagttggaaatg
cgccataaagacaaattgttggaacacgtccgcaacatcctgccgccgaacattacctgc
ctctacatccgtcaggcggaagcactgggattgggacacgccgtcttgtgcgcccgcgcc
gccatcggcgacgaacccttcgccgtcatccttgccgacgacttaatcgatgcgcccaaa
ggcgcgctcaaacaaatggtcgaagtgtacgggcgcagcggtaacagcattttgggcgta
gaaaccgtcgaaccgtcgcaaaccggctcatacggcatcgtcgaaaccgaacagctcaaa
cagttccaacgcattaccggcattgtcgaaaaacccaagcccgaagacgcgccctccaac
cttgccgttgtcggacgctacatcctcaccccgcgcattttcgaccttttaaccggcctg
ccgcgcggcgcgggcaacgaaatccagcttacagacggcatcgccaagctgctcgatcac
gaatttgtcttggcgcacccctttgaaggcacgcgctacgactgcggcagcaaactcggc
tatctcgaagccaccgtcgcctacggtttaaaacaccccgaaaccggcgaacccttccgc
cgccttttggaaaaataccgcaccgaataa

DBGET integrated database retrieval system