KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0383Help
Entry
NGK_0383          CDS       T00728                                 

Definition
(GenBank) TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGK_0383
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGK_0383
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGK_0383
Enzymes [BR:ngk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NGK_0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
317968..318795
Genome map
AA seq 275 aa AA seqDB search
MYFTAYLPIGWKRQMSRIRQAFAALDGGKALIPYIAVGDPDIRTTLALMHGMVASGADIL
ELGVPFSDPMADGPVIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPIHK
MGYREFAQEAAKAGVDGVLTVDSPIETIGSLYRELKDNEVDCIFLIAPTTTEDRIKTIAE
LAGGFVYYVSLKGVTGAASLDTDEVSRKIEYLRQYIDIPIGVGFGISNAESARKIGRVAD
AIIVGSRIVKEIENNAGNEAAAVGALVKELKDAVR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgtattttacggcgtatttgccgataggatggaagagacaaatgagcagaatccggcag
gcttttgccgctttggatggcggaaaggcattgattccctatattgcggtgggcgacccc
gatattcggacaactttggcattgatgcacggcatggttgcaagcggtgcggatattttg
gagttgggcgtgccgttttccgatccgatggcggacgggccggttattcagcgtgcggcg
gagcgggcgttggcaaacgggatttcgctgcgcgatgtcttggatgtcgtcagaaaattc
cgtgaaaccgacacgcaaacgccggttgttttgatgggatatttgaatcccatacataag
atgggttatcgggagtttgctcaggaagccgcaaaggcgggggtggacggcgtgttgacg
gtggattcccccatcgaaaccatcggttctttatatcgcgagctgaaggataacgaggtc
gactgtattttcctgattgcgccgacgacgacggaagaccgtattaaaaccattgccgag
ctggcaggcggatttgtctattatgtttcgctcaagggcgtaacgggcgcggcaagtttg
gatacggatgaggtttcgcgtaaaatagagtatttgcgtcagtatatcgatattcccatc
ggtgtcggtttcggcatcagcaatgcggaaagcgcgcgcaaaatcggccgggttgccgac
gcgatcattgtcggcagccggattgtgaaagagattgaaaacaatgcgggcaacgaggct
gccgccgtcggtgctttggtcaaagagttaaaggatgccgtgcgctga

DBGET integrated database retrieval system