KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0418Help
Entry
NGK_0418          CDS       T00728                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGK_0418
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGK_0418
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGK_0418
Enzymes [BR:ngk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NGK_0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
342817..344019
Genome map
AA seq 400 aa AA seqDB search
MKNYHAPDEKGFFGEHGGLYVSETLIPALKELEQAYNEAKNDPEFWAEFRRDLKHYVGRP
SPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLARRMGKKRVIAETGAGQH
GVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVIGVDSGSRTLKDAMNEAMR
EWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEAIGRQPDVAVACVGGGS
NAIGLFYPYIEEENVRLVGVEAGGLGVDTPDHAAPITSGAPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALEAFDLLCRFEGIIPALESSHA
VAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIEL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactaccacgcgcccgacgaaaagggctttttcggcgaacacggcgggctttat
gtttccgaaaccctgattcccgctttgaaagagctggaacaggcctacaacgaagcgaaa
aacgatcctgaattttgggcggagttccgccgcgatttgaaacattatgtcggcaggccc
agccccgtttaccacgccgcgcggttgtccgagcatttgggcggcgcgcaaatctggttg
aagcgcgaagacttgaaccacaccggcgcgcacaaggtcaacaacaccatcggtcaggca
ttgcttgcccgccgtatgggcaaaaaacgcgtcatcgccgaaaccggcgcgggtcagcac
ggcgtggcttctgccaccgtcgccgcacgtttcggcatgacttgcgacgtgtacatgggt
gcggacgatattcaacgccaaatgccgaatgtgttccgtatgaagctgcttggtgcgaat
gtcatcggcgttgacagtggcagccgtactttgaaagacgcgatgaacgaagcgatgcgc
gaatgggtcgcccgagtggacgatacgttctacatcatcggcaccgccgccggccccgcg
ccgtatcccgaaatggtgcgtgatttccaatgcgtcatcggcaacgaagccaaagcgcag
atgcaggaagctatcggcagacagcccgacgtcgccgttgcctgcgtcggcggcggctcg
aacgccatcggtttgttctatccctatatcgaagaagaaaacgtacgtttggtcggcgta
gaagcaggcggtttgggcgtggatacgcctgaccacgccgcgccgattacttcgggcgca
ccgattggcgtactgcacggcttccgcagctatctgatgcaggacgaaaacggccaagtc
ttggggacgcactctgtttccgcaggcttggattaccccggcatcggcccggaacacagc
catctgcacgacatcaagcgcgtcgaatacaccgttgccaaagatgacgaagcactcgaa
gcctttgacttgctctgccgattcgagggcatcatccccgcgctcgaatccagccacgcc
gttgcttgggcggtgaaaaacgcgccgaaaatgggtaaagaccaagtgattttggtcaac
ctgtcgggtcgcggcgacaaagacatcaataccgtggcgaaactcaaaggcattgagctg
tag

DBGET integrated database retrieval system