KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0516Help
Entry
NGK_0516          CDS       T00728                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NGK_0516 (hemD)
Enzymes [BR:ngk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NGK_0516 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
421731..422495
Genome map
AA seq 254 aa AA seqDB search
METAKPVMLIVRPSGRAKDDVEVCRRAGWQAEVLSPIEIETDEASLKRLPEMYARADAVF
WVSPAAVETAVPYLNLSDGIKAHIAVGQGSRRALARYAGAGVFAPEDGNDSEAVLRLPVW
NSLPEGARVLSVRGHGGRDFLMNALQEKGFRTEVAEVYFRRHKPLNFQNFQTENIAAAYI
TSTELVQSLFAQLPPQFSRFFKSLLYFTHHPRIAEALKREGVCSVETVPTLEAALSYSSI
SVSDGMVFPGTSNQ
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagcgaagcccgtcatgctgattgtccgcccgtcgggcagggcgaaggacgat
gtggaagtctgccgtcgtgccggatggcaggcggaagtgttgagtccgattgaaatcgaa
accgacgaagcaagcctgaaacggctgccggaaatgtatgcccgtgcggatgccgtgttt
tgggtcagtccggccgccgttgaaaccgccgtcccgtaccttaacctttcagacggcata
aaggcgcacattgccgtagggcaaggcagccgccgtgccttggcgcgttatgcgggcgcg
ggcgtgtttgcacctgaagacggcaacgacagcgaggcggttttgcgcctgccggtttgg
aacagtctgcccgaaggtgcgcgcgtattgtctgtgcgcggacacggcgggcgggatttt
ctgatgaatgccttgcaggagaaaggttttcggacggaggtggcagaagtctatttcaga
cggcataaacctttgaactttcaaaatttccaaaccgaaaatattgccgccgcctatatt
acgtccacagaacttgtgcagtcgctgtttgcacagcttccgccgcaattttcccgattc
ttcaaatccttgctatactttacccatcatccgcgcattgcggaggcattgaagcgcgaa
ggcgtgtgttcggtcgaaaccgtccctacgctggaagccgcgctttcctattcttccatt
tccgtttcagacggcatggtctttcccggaacctcaaaccaataa

DBGET integrated database retrieval system