KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0545Help
Entry
NGK_0545          CDS       T00728                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NGK_0545
Enzymes [BR:ngk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NGK_0545
Exosome [BR:ngk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NGK_0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
449827..450828
Genome map
AA seq 333 aa AA seqDB search
MQFPYRNVPASRMRRMRRDDFSRRLMREHMLTADDLIYPVFVLEGAAREEDVPSMPGVKR
QSLDRLLFTAEEAVKLGIPMLALFPVVTANKTGRAQEAYNPEGLVPSTVRALRERFPELG
IMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAEAGTQVVAPSDMMDGRIG
AIREALEDAGHIHTRIMAYSAKYASAFYGPFRDAVGSSGNLGKADKKTYQMDPANTDEAL
HEVALDIQEGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQVSGEYAMLQAAVANGWLDG
GKVVLESLLAFKRAGADGILTYYAIEAAKMLKR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttccttaccgcaatgttccggcttcgcgtatgcgccgtatgcgcagggatgat
ttttcacgccgcctgatgcgcgagcatatgctgaccgccgatgatttgatttatccggtg
ttcgtattggagggggcggcgcgcgaggaggatgtgccttctatgccgggcgtgaagcgt
cagagtttggacaggctgctgtttacggcggaagaggcggtgaagctcggtattccgatg
ttggcactctttcccgtggttacggcaaacaaaaccgggcgtgcgcaggaggcgtacaat
cccgaaggactcgtgccgtcaactgtccgagccttgcgcgagaggtttcccgaactgggc
attatgacggatgtcgcgctcgatccttatacggtgcacggtcaggacggactgacggac
gaaaacggttacgtgatgaatgatgaaaccgtagaagtcttggtgaaacaggctttatgt
catgcagaggcgggcacgcaggtcgttgctccttccgatatgatggacgggcgtatcggc
gccatccgcgaggctttggaggatgccggacatatccatacgcggattatggcatattcc
gccaaatatgcttctgcattctacggccctttccgtgatgcggtaggcagttcgggcaat
ttgggaaaggcagataaaaagacctatcagatggatcctgcaaataccgatgaggcgctg
catgaagtggcgctcgatattcaggaaggtgcggatatggtgatggtgaagcccggtttg
ccgtatttggacgttgtccgccgcgtgaaggacgagttcggcgtaccgacttatgcctat
caggtttcgggcgaatatgcgatgttgcaggcggcggttgccaacggctggctggacggc
ggcaaagtggttttggaaagcctgctggcattcaaacgtgcgggtgcggacgggattttg
acctattacgccattgaggcggcaaagatgctgaagcgttga

DBGET integrated database retrieval system