KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0798Help
Entry
NGK_0798          CDS       T00728                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGK_0798
  Amino acid metabolism
   00300 Lysine biosynthesis
    NGK_0798
Enzymes [BR:ngk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NGK_0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
650598..651833
Genome map
AA seq 411 aa AA seqDB search
MPVLYTNPTRRSSENQLQDISDDLISKVNKMTETQSLELAKALISRPSVTPDDRDCQKLL
AERLHKIGFAAEELHFGDTKNIWLRRGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPTER
DGRLYGRGAADMKTSIACFVTACERFVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVL
KARGELIDYCIVGEPTAVDKLGDMIKNGRRGSLSGNLTVKGKQGHIAYPHLAVNPVHTFA
PALLELTQEVWDEGNEYFPPTSFQISNINGGTGATNVIPGELNVKFNFRFSTESTETGLK
QRVHAILDKHGVQYDLQWSCSGQPFLTHAGKLTDVARTAIAETCGVEAELSTTGGTSDGR
FIKAIAKELIELGPSNATIHQINENVRLDDIPKLSAVYERILARLLAEKAV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcttatacaccaatccaacccggaggtcgtctgaaaatcagcttcaggacatt
tcagacgacctgatttccaaagtgaacaaaatgaccgaaacccaatccctagaactcgcc
aaagcgttgatttcccgcccgtccgttacccccgacgaccgagattgccaaaaactgctt
gccgaacgcctgcacaaaatcggttttgcggctgaagaactccatttcggcgacaccaaa
aacatctggttgcgacgcggcacgaaagctcctgtcgtctgttttgcagggcataccgac
gttgtgccgacaggtcctgttgaaaaatgggattcgcccccgttcgaaccgaccgagcgc
gacggaagattatacgggcgcggcgcggcggacatgaaaaccagcatcgcctgtttcgtt
accgcctgcgaacgctttgttgccgaacatcccgaccatcaaggcagcattgcactcttg
attacttccgacgaagagggcgatgcactggacggcacgaccaaagtcgtcgatgtgttg
aaagcacgcggagagttgattgactactgcatcgtcggcgaaccgaccgccgtggacaaa
ttgggcgatatgattaaaaacggccggcgcggttcgctgtcgggcaatctgaccgtcaaa
ggcaagcaagggcatatcgcctatccgcatttggcggtgaatcccgtgcatacttttgcc
ccggccttgttagagttgacgcaggaagtttgggacgaaggcaacgaatacttcccgccg
accagctttcaaatttccaatatcaacggcggcacaggcgcgaccaacgtcattccgggc
gagctgaacgtcaaattcaatttccgcttctccacagagtccaccgaaacagggctgaaa
caacgcgtccacgccattttggacaaacacggcgtgcaatacgatttgcagtggtcgtgt
tcgggacagcccttcctgacccacgcgggcaaactgaccgacgtggcacgcaccgccatt
gccgaaacctgcggcgttgaggccgaattgtccaccaccggcggcacttcggacggacgc
ttcattaaagccattgcgaaagaactcatcgaattaggcccgtccaatgccaccatccac
caaatcaacgaaaatgtgcggctggacgatattccgaagctgtcggcggtgtatgagagg
atattggcgcggttgttggctgaaaaggccgtctga

DBGET integrated database retrieval system