KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0883Help
Entry
NGK_0883          CDS       T00728                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ngk01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ngk00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ngk00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
717923..719104
Genome map
AA seq 393 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATVAAEAPAAAPAEAAPAAVPAAAQNNAAMPAAAKLAAETG
VDVNVLQGSGRDGRVLKEDVQNAAAKPAAAVAPAVALPAGARPEERVPMSRLRARVAERL
LASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVTALKKYPVV
NASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIA
IEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLAL
SYDHRIIDGREAVLTLVAIKDALEDPVRLLLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacactcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcccgtatcgatacagctgct
actgtcgctgctgaagcacctgcagccgctcctgccgaagctgccccggctgccgttcct
gctgctgcacaaaacaacgccgccatgcctgccgctgcaaaactggctgccgagaccggt
gttgacgtgaacgtattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccgcagccgtggcccctgccgttgcacttcctgccggc
gcacgtcctgaagaacgcgtaccaatgagccgcctgcgtgcccgtgttgcagaacgcctc
ttggcttctcaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaaccg
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacatggcgtaaaactg
ggctttatgtccttcttcgttaaagccgctgttacagccctgaaaaaatacccggttgtg
aatgcttctgttgacggcaaagacattgtgtaccacggctacttcgacatcggtatcgca
attggcagcccacgcggtttggttgtaccaatcctgcgcgatgccgaccaaatgagcatt
gccgacatcgaacaagcaattgttgattacgcgaaaaaagccaaagacggcaaaatcgct
atcgaagacctgaccggcggtacattcagtattaccaacggcggtactttcggttctatg
atgtccaccccgatcatcaacccgcctcaatctgcgattttgggtatgcatgccactaaa
gagcgcgctgtggttgaaaacggccaagttgttgtccgtccaatgatgtatctggctctg
tcttacgaccaccgtatcattgacggccgcgaagctgtattgaccttggtagccattaaa
gacgcgttggaagacccggtccgcctgttgttggatctgtaa

DBGET integrated database retrieval system