KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1080Help
Entry
NGK_1080          CDS       T00728                                 

Definition
protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(881871..882431)
Genome map
AA seq 186 aa AA seqDB search
MGDNIAYVQENGRYFIFGALYDMQEQKDLTEMARSAVTQKSYSRLPFKNAIKIVKGNGGK
GKREFALFSDPDCPFCRRLEETLAGMTDYTAYVFMFPIKSLHPDAISKAEHIWCSKDREK
AWNNYMLMDKEPAAGNCKNPVSENIALAEQLKVRGTPSMIHKDGRRTSGAMPRAELEKWL
NGAGAE
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacaacattgcctatgtacaagaaaacggtcgctatttcatttttggcgcgttg
tacgatatgcaagagcagaaagacttgaccgagatggcccgttcagcggtaacacaaaag
agttattcccgactgccattcaaaaacgccatcaaaatcgttaaaggtaatggcggcaaa
ggcaagcgagaatttgcacttttttccgacccggattgcccgttctgtcgtcgtttggaa
gaaacattggccggcatgacagactataccgcatacgttttcatgttcccgattaaatcc
ctccaccctgatgcaatttcaaaagcagaacatatctggtgcagtaaagatcgtgaaaaa
gcatggaataactacatgctgatggataaagaaccggcggccggtaactgtaaaaaccct
gtatcagaaaatattgcactcgcagagcagcttaaagttcgcggtactccaagcatgatt
cataaagatggtcggcgtacatccggtgccatgccgcgtgccgaattggaaaaatggtta
aatggagcgggagcagaatga

DBGET integrated database retrieval system