KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1106Help
Entry
NGK_1106          CDS       T00728                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NGK_1106
Enzymes [BR:ngk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NGK_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(904470..906248)
Genome map
AA seq 592 aa AA seqDB search
MPSDGISTRNTMELQTDEFAQAAARAAIRFLERYAGSGNEVLANCTERLFQALQNGHSFI
RLSGDEADALSALAPVVGTSAAPLILEGRRLFLGRMWQLEYDLAAEIKRLAAAGTSAPDA
AGARQNLAKWFQGAGSEGQRDAAALALLQFFMVITGGPGTGKTTTVAKLLALICGENENL
PHIALAAPTGKAAAHMARALHRAINGFDAPEAVRRHLLKLEGQTVHRLLKLSPPKMQAAF
DHIRPLPFDVLIVDEASMLDTALMLQLLKAVKTGARVILLGDENQLPSVGIGAVLSVLSQ
KTVLDGETHQRLAGFLPEHGFSVSANPPVLAQNTAHLSFSHRFGDNSGIGCLARAAVSGD
EGAWALFDRFPDELEHSECSPNARVERLYRAHKAYWQAVKDGNIEAAYAGISDIVVLAAW
RQDAEDFNEAYCSYVRRKMNIPEHLAYFAGEPIMIRQNDYALELFNGDIGLIMEDVGRQG
SLAAYFADADGFKKVAVSCLPEFEPAFAMTVHKSQGSEYREVWLLPPSDAPSDEGDDALS
GLSKELLYTAITRAREKFVFFGGKKTFCQAVNTVKVRQTALGSMLERVFSQE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgccttcagacggcatttcgacaaggaatacgatggaactgcagacagatgaatttgcc
caagcggcggcaagggcggcaatccgttttttggaacgctatgcgggttcgggcaacgaa
gtgcttgcaaactgtaccgaacgcctgtttcaggcattgcaaaacggtcattcgtttatc
cgtttgagcggggacgaggctgacgcgctgtcggcactcgcacccgtggtcggaacatcc
gccgcgcctttgattttggaaggcagaaggctgtttttgggcaggatgtggcagttggaa
tacgatttggctgccgaaataaaacgcttggcggcagccggcacgtccgcccccgacgcg
gcaggcgcgcggcaaaacctcgcaaaatggtttcaaggcgcgggaagcgaaggacagcgc
gatgcggccgccttggcactgttgcagttttttatggtgattaccggagggccgggaacg
ggcaaaacgacaacggttgccaaactgctggcactgatttgcggtgaaaacgaaaatctt
ccccatatcgcgcttgccgcaccgacgggcaaagcggcggcacatatggcgcgcgcgctg
caccgtgcaatcaacggttttgacgcgccggaggccgtccgccgccatttgctcaaactg
gaagggcaaaccgtccaccgactgcttaagctgagcccgcccaaaatgcaggcggcgttc
gaccatatccgtccgctgccgttcgacgtgctgattgtcgatgaagcctccatgttggat
accgcattgatgctgcaacttttgaaagcggtcaaaaccggcgcgcgcgtgattctgctg
ggcgatgaaaaccagctcccgtccgtcggaatcggggcggtgctgtcggttttgtcgcaa
aaaaccgttttggacggagaaacgcaccaaaggctggccggtttccttccggaacacggt
ttcagcgtcagcgcaaatccgcccgtgttggcgcaaaacaccgcccatctgtcgttcagc
caccgcttcggcgacaacagcggcatcggctgccttgcccgtgccgccgtatcgggcgat
gaaggggcgtgggcattgtttgaccggtttccggacgaactggaacattcggaatgcagt
ccgaatgctcgggtcgaaaggttgtaccgggcgcacaaagcctattggcaggcggtaaaa
gacggcaatatcgaagccgcatacgcaggcatctcggatatcgtggttctggcagcttgg
cggcaggatgcggaagacttcaacgaagcctattgcagctatgtacgccgcaaaatgaac
ataccggaacatttggcctatttcgccggagagccgattatgatcagacagaacgactac
gcgcttgagctgttcaacggcgacatcggactgattatggaagatgtcggacggcagggc
agccttgccgcctattttgccgatgcggacggatttaaaaaggtagcggtaagctgcctg
cccgaatttgaacccgcattcgccatgaccgtccacaaaagccaaggttcggaatatcgg
gaagtctggctgctgccgccttccgacgcaccttcggacgaaggggacgatgcattgtcc
ggattgagtaaggagctgttatataccgccattacccgcgccagggaaaaattcgtattt
ttcggcggcaaaaagacattttgtcaggcggtaaacaccgtcaaagtccgtcagacggcg
ttgggcagtatgcttgagcgggtattttcacaagaataa

DBGET integrated database retrieval system