KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1111Help
Entry
NGK_1111          CDS       T00728                                 

Definition
(GenBank) putative recombination protein
  KO
K06187  recombination protein RecR
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NGK_1111
DNA repair and recombination proteins [BR:ngk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     NGK_1111
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NGK_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecR Toprim_4 Toprim
Motif
Other DBs
NCBI-ProteinID: ACF29788
UniProt: B4RLV1
Position
complement(908777..909397)
Genome map
AA seq 206 aa AA seqDB search
MMNSKKQDAFQRLIGALKVLPNVGPKSAQRMAYHLLQQKRKEAEELVDALQTALRQVRHC
ARCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNIEAANCHDGLYFVLMGQINTALGM
DVSAIALDRLAQRLDGGEIEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLG
GELEYVDAGTLAQAVYERRLIKEGGA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattccaaaaaacaggatgcattccaacgcctgatcggtgcgctgaaagtattg
cccaacgtcgggccgaaatcggcacagcggatggcgtaccatctgttgcagcaaaagcgc
aaagaggctgaagagctggtggatgccttacagacggcattgaggcaggttcgccattgc
gcaaggtgcaatacattttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgc
gacgggcggcggctgatggtggtgcatatgcctgccgacgtgtcgaatatagaagcggca
aactgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatg
gacgtatccgccatcgcattggacaggctggcgcaacggctggacggcggggaaatcgaa
gaaatcattatcgcgaccgcctttaccgcagaaggcaatgccacagcgtatgtcctgtcc
gagtttttcaaaaacctgccttacaaggtcagcaggctgtcgcagggcatcccattgggc
ggcgaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacggcgtctg
attaaagaaggcggggcgtaa

DBGET integrated database retrieval system