KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1217Help
Entry
NGK_1217          CDS       T00728                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGK_1217
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGK_1217
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NGK_1217
Enzymes [BR:ngk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NGK_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
991918..993384
Genome map
AA seq 488 aa AA seqDB search
MRQMPSESVFLQFRQTRKIMRYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRE
TLDKWRGLAYPELAFEIMCLFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKI
QALSNGPTLAFKDMAMQFLGNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNV
FMLSPDGKMSAFQRAQMYSLQDGNIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVN
SINWGRIVAQVVYYFAGYFNATSSNDETVSFCVPSGNFGNVCAGHIAKQMGLPVRCLIVA
TNENDVLDEFFKTGAYRPRNSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTLWA
EVAAGKGFDLRFALDKVGGKYGFTSGKSTHADRLATIRQVYEQDKELIDPHTANGVKVAR
EVREAGETVVCLETALAAKFDATIREAVGDVAIPRPAALEGLENLPQRVQTVPNSADAVK
GIIEQTLA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagatgccgtctgaatccgttttcctgcaatttcgacaaacgagaaaaatcatg
agatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattgatg
gggcttgcacccgacggcggactgatgctgccggaacattatccgcaaatcgggcgcgaa
accttggacaaatggcgcggtttggcttatcccgaattggcgtttgaaatcatgtgcctg
ttcgttaccgatattccggaggacgatttgcgcgacattctgaaccgtacttacacggaa
gcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaaatc
caagccttgtccaacggcccgacgctggcgttcaaagatatggcgatgcagtttttgggc
aatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgcaacc
agcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaaaggcgtgaacgta
tttatgttgtcgcccgacggtaaaatgagcgcgttccaacgcgcgcagatgtacagcctg
caagacgggaatatccacaatatcgccgtgaaggggatgtttgacgactgccaggacatt
gtgaaggcagtgcagaacgatgccgcgttcaaggaaaaataccatatcggtacggtcaat
tcgatcaactgggggcgcatcgtcgcgcaagtggtttattactttgcaggctatttcaat
gccacttcaagcaatgacgaaaccgtcagcttttgcgtaccgagcggcaacttcggcaac
gtttgcgcgggacacatcgccaaacaaatgggcctgcctgtccgctgcctgattgtcgcg
accaatgaaaacgatgtgctggacgagtttttcaaaaccggcgcataccgcccgcgcaac
agcgcgcatacttatgtaacctccagcccgtctatggacatttccaaagcgtccaacttc
gagcgtttcgtgttcgacctgatggatcgcgatcctcaggaaatcaatacgctgtgggcg
gaagtcgcggcaggcaaaggctttgacctgcggtttgccttggacaaagtcggcggcaaa
tacggctttacctccggcaaatctacccacgccgaccgcctcgccaccatcagacaggtt
tacgagcaagacaaagaactcatcgacccgcatactgccaacggcgtaaaagtcgcccgc
gaagtgcgcgaagcgggggaaacggtggtttgtttggaaaccgcgttggcggcgaaattc
gatgcgaccatacgcgaagccgtcggcgatgtcgccattccgcgccccgccgcgctggaa
ggtttggaaaacctgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggtaaaa
ggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system