KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1274Help
Entry
NGK_1274          CDS       T00728                                 

Definition
protein Rmsprotein R
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1042499..1045273
Genome map
AA seq 924 aa AA seqDB search
MANNKTLFDWVEDRKSMLEEMEQTDFFALPEFVSNNLKYPFFEWQKSALENFVIFDRTSK
LKDFPDIKNRPTHLLFNMATGAGKTMMIAALILYYFEKGYRHFLFFVNKNNIVYKTENNF
IDPTHPKFLFTEKILQGDTVIPIRKVETFSQYSDGIEIKFTSIQKLYNDIHTERENQTTL
ADLHELNLVMLGDEAHHLNAQTKGKKQGELDLEKEMNDRTSDAEIERKGWEHMVLELLLN
KNGNPGQNVLLEFTATLPENTEVQQKYADKIITKFGLKEFLQKGYTKEINLVSGTLNKKE
RVLHALLFAWYRHQIALKYGIANFKPVMLFRSKTIDESKADYLAFLNWVENVQADDFSFL
TTFSTSLNDSNNANEQGKTRTEQALKFMQENKFEFVHLANWIKQNYQKHNVIITNSETNK
NKTEKTDSETEKLLNNLEAADNPIRAIFTVDRLTEGWDVLNLFDIVRLYEGQNGGGSNKK
SGKTAAATVSEKQLIGRGVRYFPFAFEGKQPNKRKFDNDMQHELRILEELFYYTHDEQSR
YITELKNELRKDGYLPEKDDDKVLATFKLKSEFADNKDFRELLIWANKKIPNPNAKSNNA
DSLQANPQTLSFQVHGNQLLQETQFTADENDETARQIGTQNNFTQTIKMSEMERHIFNKA
LHIKGKNSQSLFHFDRLQSKLDIQNRNELQNKLLKDWQIEFLGLEQDKQVRPDDKLAGCL
KILEMVEKHLNESDIPFIGTKEFTPKKLWEIFGTPKQKWVKKDDIKTAIATQNDWYVMDN
FAGTGLEEALIQFISARLGDLKSQYDVHLIRNEEVFKLNNFADGEGFMPDFVLLLKDKQK
SSSDSVDDFLHYQIFIEPKGGHLVENDSWKEAFLKSITVEYGRDKILQKNTPHYRLIGLP
FFTDHQKNGQFTELFPLGAASLEK
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggcgaataataaaacgttgtttgattgggtggaagaccgcaaatcaatgctggaagaa
atggaacagacggattttttcgcgctgcctgaatttgtttccaataatttaaaatatccg
ttttttgaatggcaaaaatcggctttagaaaattttgtgatttttgaccgcacttcaaaa
ttaaaggatttccccgacatcaaaaaccgccctacccatttgctgttcaatatggcaaca
ggtgcaggcaaaacgatgatgatagcggcattgattctgtattattttgagaaagggtat
cggcattttttatttttcgtcaataaaaacaatatagtatataaaacggaaaataatttt
atcgacccgacgcatccaaaatttttatttaccgagaaaattttgcaaggtgatacggta
attcccattcgcaaagtggagacatttagccaatattcagacggcattgaaattaaattt
accagcattcaaaaactatataacgatattcacaccgagcgggaaaatcaaaccacattg
gcggatttgcacgaattaaatcttgtgatgctgggcgatgaagcacaccatttaaacgcg
caaaccaaaggcaaaaaacaaggcgaattagatttagaaaaggaaatgaacgaccgtacc
agcgatgccgaaattgaacgcaagggttgggagcatatggttttggagttgttactcaat
aaaaatggcaatcccggccaaaatgtgctgttggaatttaccgccacgctgcctgaaaat
actgaagtgcaacaaaaatatgctgataaaatcatcacaaaatttggtttaaaagaattt
ttgcaaaaaggttataccaaagaaatcaatttggtatccggtacgctgaataagaaagag
cgggtgttgcacgctttattgtttgcctggtaccgccatcaaatcgcgttgaaatacggc
attgccaatttcaagcctgtgatgttgtttagaagtaagacgattgatgaatcaaaagcg
gattatttggcatttttaaattgggtagaaaatgtgcaagcggatgatttttcgttttta
actacattttcaacaagcttaaacgatagcaataacgccaacgaacaaggcaaaacccgt
accgaacaagccctgaaatttatgcaggaaaataaatttgaatttgtgcatttggcaaat
tggattaaacaaaattatcaaaaacacaatgtcattattaccaactccgaaaccaacaaa
aacaaaactgaaaaaaccgacagcgaaaccgaaaaattgctgaacaatctggaagcggct
gataatccgatccgtgccatttttacggtggatagattaaccgaaggttgggacgtttta
aatttgtttgatattgtgcgtttgtatgaagggcaaaacggtggcggttcgaataaaaaa
tcaggcaaaacggctgccgccaccgtatcggaaaagcagttgattggtcgcggcgtgcgt
tattttccatttgcgtttgaaggtaaacagccgaataaacgcaaatttgacaacgatatg
caacatgaattgcgtatcttggaagaattgttttattacacgcacgatgagcaatcccgc
tatattacagaactgaaaaacgagttacgaaaagacggttatttgcctgaaaaagacgat
gataaggtattggcaacatttaagctcaaatctgaatttgcagataataaggattttaga
gagttgttaatttgggcgaataaaaaaatccccaacccaaacgccaaaagcaataatgca
gacagcctgcaagccaatccgcaaacgctttcattccaagttcacggtaatcaactgttg
caggaaacgcaatttacagccgatgaaaatgatgaaacagcccgacaaatcggcacacaa
aataattttactcaaaccataaaaatgagtgaaatggagcggcatattttcaataaagca
ttacatatcaaagggaaaaatagtcaatctttattccattttgaccgcctgcaaagcaaa
ctcgacattcaaaatcgcaatgaattgcaaaataaattgttgaaagactggcagattgaa
tttttgggattagagcaagataaacaggttcgcccggatgataaacttgcaggctgcctg
aaaatcttggaaatggttgaaaaacatctgaatgaaagtgatataccgtttatcggtaca
aaagaatttacacctaaaaaattgtgggaaattttcggcacgccaaaacaaaaatgggtc
aaaaaagatgatataaaaactgctattgccacgcaaaatgattggtatgtgatggataat
tttgccggaacgggtttggaagaagcgttaattcaatttatttcagcgcgcttgggcgat
ttgaaatctcaatatgacgttcatttaatccgcaatgaagaagtgtttaaattgaataac
tttgccgatggcgaaggatttatgccggactttgttttattgctgaaagataaacaaaaa
tcttcttccgacagcgtggacgactttttgcattaccaaattttcattgaaccgaaaggc
gggcatttagtggaaaatgattcgtggaaagaagcttttttaaaatcaatcacagtggaa
tatgggagggataagatcctgcaaaaaaatacaccgcattatcgtttgatcggtttgccg
ttttttactgatcatcagaaaaatggacaatttacagagttattccctttaggtgcggca
tcgcttgaaaaatag

DBGET integrated database retrieval system