KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1306Help
Entry
NGK_1306          CDS       T00728                                 

Definition
(GenBank) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    NGK_1306
Enzymes [BR:ngk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     NGK_1306
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     NGK_1306
DNA repair and recombination proteins [BR:ngk03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     NGK_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS DUF1631 FbpA
Motif
Other DBs
NCBI-ProteinID: ACF29981
UniProt: B4RME6
Position
complement(1074232..1075122)
Genome map
AA seq 296 aa AA seqDB search
MRIKGRPSFRRHLSEEMSGGVMPELPEVETTLRGIAPHIEGKTVEAVILRQLKLRWQINP
DLGEILSGRQVLSCGRRAKYLIVRFQTGILLIHLGMSGSLRIFTPSDGRIGRPDRHDHVD
IVFSDGTVMRYRDPRKFGAILWYEGIEERHPLLEKLGPEPLSEAFCTDYLYAGLKAQKRA
VKLALMDNTVVVGVGNIYANESLFRAGISPHRPANRLKKKECAVLVETVKAVLQRAIETG
GSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCLRCGGLVVKETLGQRGTFYCTNCQK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgcggattaagggacggccgtctttcagacggcatctgtcagaagaaatgtcgggaggg
gttatgccggaattgccggaagtggaaacgacgttgcgcggcatcgcgccgcatattgaa
ggaaaaacggtggaagccgtgatattgcgccaactgaagctgcgctggcagatcaatccc
gatttgggggagattttgtccggccggcaggttttgtcctgcggcaggcgtgccaaatat
ctgattgtccgtttccaaacggggattttgctgattcacttggggatgtcgggcagcttg
cggatctttacgccgtcggacggacgtatcggcaggccggacagacacgatcacgtcgat
attgtgttttcagacggcacggtcatgcgttaccgcgatccgagaaagttcggcgcgata
ctttggtatgagggaatcgaagaacgtcatccgctgttggaaaaactggggccggagcct
ttgtcggaggcattttgcacggattatctgtatgcggggctgaaggcgcagaaacgcgcg
gtcaaactcgctctgatggacaataccgtcgtggtcggcgtgggcaatatttatgccaac
gagagtctgttcagggcgggcatttcgccccaccgtcctgccaaccgcctaaaaaagaaa
gagtgcgcggttttggttgaaaccgtcaaagcggtgttgcagcgcgccattgaaacgggc
ggcagtacgctgagggattttgtggacagcgacggcaaaagcggctactttcaacaggaa
tatacggtgtacgggcggcacaatcagccgtgcctccggtgcggcggtttggttgtgaaa
gaaactttggggcagcgcggcacgttttattgcacgaactgtcagaaatag

DBGET integrated database retrieval system