KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1383Help
Entry
NGK_1383          CDS       T00728                                 

Definition
Type III restriction-modification system EcoPI enzyme, subunit res
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Brite
Enzymes [BR:ngk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     NGK_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1149267..1152206)
Genome map
AA seq 979 aa AA seqDB search
MSGFNYEKNQPHQMRAVSAVLGVFDGATPKYRTADENPELLFAAKQYANNILKVQSQNGI
DGRFPDRSDDQNILDISMETGTGKTYTYTQTMFELHRWLGVFKFIVVVPTLSIKAGTQQF
LQSKALAEHFEQDFGGDYEGVRLKTYVVESAKKNKGKKSNAPITIEQFVKAENKKEIHVL
LINAGMVNSSSMNDTGDKALKDLFDNPVDALAAVRPFMIVDEPHKFPTRDSAKTWGNIKR
LKPQYILRYGATFNDEYYNLLYRLTAVDAFNDGLVKGVRVFQEEMQGGMDAAVKLVSSDG
KEAKFELNEKDKKQTFKLAKGEDLAQIHPAISDLKIDKMNKTVVVLSNGLELKTGAVINP
YSYSQTVQDAMMQRAVAEHFKLERALLAERAPQPKIKPLTLFFIDDIAGYRSGNELSGSL
KDKFESWIRAEAARRLKTESDPFYRDYLQKTLDDVSACHGGYFSKDNTDSDDRIEQEINE
ILHDKEKLLSLDNPRRFIFSKWTLREGWDNPNVFQICKLRSSGSTTSKLQEVGRGLRLPV
NELMARVRDVPYKLNYFVDSSEKDFVKQLVGEINDNSFQEEISKKFTEELKQKILQKYPD
IKPLVLVNQLFSDGIIDDNENFAEDGYDKLKAAYPEAFPKGLDKGKVSNAKDEGKDTIIM
REGKYEELKALWELIHHKAVLQYKIKDEAEFVDLFTAYLRENAAKFPQAGICTAVNEAYI
NNGLMLSRRIDSIEDEDFIRFNTMTYREFLEKLAQTAKIQMQTLHQAFYRVRDELNIGDF
LNMQTIAQIKNGFNRFLLHHSFHKFELDYRLVGSKIHPTKFTNKDGKPRAVKKADLGRFE
DTEHRPAAGYLFGEIFYDSDIEHENVANNQIEGVIVFTKIPRNSIKIPVAGGGTYSPDFA
YIVKTKSGEILNFVIEAKGTDGAEDLRKSEERKIKHAEKLFAEISKEIKVVFKTQFDGER
IAELIGQNMPAGGHSENEH
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgagcggttttaattacgagaaaaaccagccgcaccaaatgcgggcggtttcggcggtt
ttgggcgtgtttgacggggcaacgcccaaatatcggacggcagacgaaaatcccgaactt
ttgtttgctgcaaaacaatacgcaaacaatatcctgaaagtgcaaagccaaaacggtata
gacggccgattccccgaccgttcggacgaccaaaatatccttgatatttccatggaaacg
ggcacgggcaaaacctatacctacacacaaaccatgttcgagctgcaccgttggctgggc
gtgttcaaatttatcgtggtcgtgccgactttgtccattaaggcgggaacacagcagttt
ttgcaaagcaaggctttggcagagcattttgaacaggatttcggcggcgattatgaaggc
gtacgcctgaaaacctatgtggtggaaagcgcgaaaaagaataagggcaaaaagtccaat
gcgcccataacgattgagcaatttgtcaaagcggaaaacaaaaaggaaattcatgtgctg
ctgattaacgcgggcatggttaattcgtcgtccatgaacgatacgggcgacaaggcattg
aaggatttgtttgacaatcccgttgatgcattggctgccgtgcgcccgtttatgattgtg
gacgaaccgcataaattcccgacccgagatagcgcgaaaacgtggggcaatatcaaacgc
ttaaaaccgcaatatattttgcgctacggtgcaacatttaacgatgaatattacaacttg
ctttaccgtttgacggcagtagacgcgtttaacgacgggctggtcaaaggcgtgcgcgtg
tttcaggaagaaatgcagggcggcatggatgcggcggtaaaactggtgtcgtcggacggc
aaagaagcgaaatttgaattaaacgaaaaggacaaaaagcagacgttcaaactggcaaaa
ggcgaagatttggcgcaaatccatccggctatttcggatttgaaaatcgacaaaatgaat
aaaaccgtggtggtgttaagcaacggcttggagttgaaaacgggtgccgtcatcaaccct
tattcctattcgcaaacggtgcaggatgcgatgatgcagcgggcggttgccgaacatttc
aagctggaacgcgcgcttttggcagaacgcgcgccacagcccaaaatcaagccgctgacg
ctgttttttattgacgatatcgcgggctaccgcagcggcaacgagctttcaggcagcctg
aaagataaatttgaaagctggattcgcgcggaagcggcacgccgtctgaaaacggaaagc
gacccgttttaccgcgattacctgcaaaagacgttggacgatgtatccgcctgccacggc
ggctatttttccaaagacaatacagacagcgacgatagaatcgagcaggaaatcaatgaa
atcctgcacgataaggaaaaactgctgtctttggacaacccgcgccgctttattttttcc
aaatggacgctgcgcgaaggctgggacaatcccaacgttttccagatttgcaaactgcgt
tccagcggcagcacgacttccaagctgcaagaagtcggacgcggcctgcgcctgccggta
aacgagctgatggcgcgggtgcgcgatgtaccgtacaaactgaattattttgtcgatagc
agcgaaaaagactttgtgaagcagcttgtcggcgaaatcaacgacaattcttttcaggaa
gaaatctccaaaaagtttaccgaagagctgaaacaaaaaatattgcaaaaataccccgat
atcaaaccgctggtattggtaaaccaactgttttcagacggcatcattgacgacaatgaa
aactttgccgaagacggctatgacaaattaaaagccgcctatcccgaagccttccccaaa
ggtttggacaaaggcaaagtcagcaacgccaaagacgagggcaaagacaccatcatcatg
cgcgaaggcaaatatgaagaactcaaagccttgtgggagctgattcaccataaagccgtt
ttgcagtacaaaatcaaagatgaagccgaatttgtcgatttatttaccgcctatttgcgt
gaaaacgccgccaaattcccgcaggcaggcatatgcacggcggtaaacgaagcttatatc
aacaacgggcttatgctttcccgccgcatagacagtattgaagatgaagattttatccgt
ttcaacacaatgacttaccgtgagtttctggaaaaactggcacaaacggcaaaaatccag
atgcagactttgcatcaggcgttttaccgcgtccgcgacgaactgaacattggcgatttt
ttgaatatgcagaccatcgcccaaatcaaaaacggcttcaaccggtttttgcttcatcat
tccttccataaattcgaactggattaccggcttgtcggcagcaaaatccatccgaccaaa
tttaccaataaagacggcaaaccgcgcgcggtgaaaaaagcagatttgggcagatttgaa
gatacggagcaccggcctgccgccggctatctcttcggcgagattttctacgattcggat
atagaacatgaaaatgtcgccaacaaccaaattgaaggcgtaatcgtatttaccaaaata
ccgagaaactccatcaaaatccctgttgccggcggcggcacgtattcgcccgactttgcc
tatatcgtgaaaaccaaaagcggcgagattctgaactttgtgattgaagccaaagggact
gacggggcggaagatttgcgaaaaagcgaagagcggaaaatcaaacatgccgaaaagctg
tttgccgagatttccaaagaaatcaaggtggtgttcaaaacgcagtttgacggcgagagg
atagccgaactgatcgggcaaaatatgccagcaggcgggcattctgaaaacgaacactga

DBGET integrated database retrieval system