KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1652Help
Entry
NGK_1652          CDS       T00728                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:ngk00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1373368..1375071)
Genome map
AA seq 567 aa AA seqDB search
MSGRQGFPGRIIKFFSHRLAVRKPVCRILSKECCMSDEKLEQNGLSRRSFLGTAAASGAG
IAGAGLLGLAGCSKDGEQAAANASGAAPVAKAQGESKPGQLSSEVGPGELDQYYGFLSGG
QSGEMRLIGLPSMRELMRIPVFNMDSATGWGRTNESLKVLNGNITEETRKFLKDGGLRCY
PNGDLHHPHLSFTDQTYDGRYAYANDKANNRVCRVRLDVMKADKIIDIPNDSGIHGLRPQ
RYPKTGYVFANGEHITPVSGVGKLDDAKTWNAVYTAIDGETMEIAWQVLVDGNLDNGDAD
YQGKYSFATCYNSERALTVQGASSNEQDWCVVFDLKAIEEGIKAGDFKEVNGVKMLDGRA
EAKSKYTRYIPVPNSPHGCNASPDGKYIMPNGKLPPTVTVLDVSKLDDLFAGKIKERDVV
VAEPQLGLGPLHTAFDGRGNAYTTLFIDSQMVKWNIDDAIKAYKGEKIDPIKQKLDVHYQ
PGHNHTTMGETKEADGQWLVSLNKFSKDRFLNAGPLKPECDQLIDISGDEMRLVHDNPTF
AEPHDLCLVAASKLNPGKTWDRKDPWF
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaggcaggcagggtttccccggaaggataataaaatttttttcccatcggcttgcc
gtccgaaaaccggtttgccgtattttatccaaggagtgttgtatgtcagacgaaaaatta
gaacaaaacggcttgagccgtcgttcgttcttaggtacggccgccgcttccggtgcaggt
attgccggtgcgggcctgttgggtttggcgggttgctctaaagacggcgaacaggctgcc
gctaacgcttccggcgcggctcccgtcgccaaggcgcaaggggaatccaaacccggccaa
ctgtcttccgaagtcggtccgggcgaactcgatcaatattacggtttcctttccggcggc
cagtccggcgagatgcgcctgatcggtctgccttctatgcgcgaactgatgcgtatcccc
gtgttcaatatggacagcgcgaccggttggggacgcaccaatgagagcttgaaagtcctc
aacggcaatattaccgaagaaacccgtaaattcttaaaagacggcggcctgcgctgctac
cccaacggcgacttgcaccacccgcacctgtcgtttaccgaccaaacttatgacggccgc
tatgcctatgccaacgacaaggcaaacaaccgcgtctgccgcgtgcgtttggatgtgatg
aaggccgacaaaatcatcgacatccctaatgattcaggtattcacggtctgcgtccgcaa
cgttatccgaaaaccggttatgtttttgccaacggcgaacacattacccctgtcagcggt
gtaggcaaactggatgatgcgaaaacctggaatgcagtgtacaccgccatcgacggcgaa
accatggagatcgcatggcaagtattggttgacggtaacctggacaacggcgatgccgac
tatcaaggcaaatattcttttgccacctgctacaactccgagcgcgcgctgaccgtacaa
ggtgcgtcttccaacgagcaggactggtgcgtcgttttcgacctgaaagccatcgaagaa
ggcatcaaagcgggcgacttcaaagaagttaacggtgtgaaaatgctggacggccgcgct
gaggccaaatccaaatacacgcgttatatccctgtgccgaactctcctcacggctgtaac
gcaagccctgacggtaaatacatcatgcccaacggtaaactgcctccaaccgttaccgta
ttggatgtcagcaaactggacgatttgttcgccggcaaaatcaaagagcgcgatgtggtc
gtagccgaaccgcaactgggtctcggcccgttacacactgcattcgacggtcgcggcaat
gcttatacgacattgtttatcgacagccaaatggtgaaatggaatattgacgatgcgatc
aaagcctacaaaggcgagaaaatcgatccgatcaaacaaaaactcgacgttcactatcaa
ccgggtcacaaccatacgaccatgggcgaaaccaaagaagccgacggtcaatggctggtg
tccttgaacaaattctccaaagaccgcttcttgaatgccggtcctttgaaacccgagtgc
gaccaattgatcgacatctccggcgacgaaatgcgtctggtacacgacaacccgactttt
gccgaaccgcacgacttgtgtttggttgccgcgtccaaactgaacccgggcaaaacttgg
gaccgcaaagacccgtggttctag

DBGET integrated database retrieval system