KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1758Help
Entry
NGK_1758          CDS       T00728                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NGK_1758
Enzymes [BR:ngk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NGK_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1456423..1457346)
Genome map
AA seq 307 aa AA seqDB search
MQYSTLAGQTDNSLVSNNFGFLRLPLNFMPYESHADWVITGVPYDMAVSGRSGARFGPEA
IRRASVNLAWEHRRFPWTFDVRERLNIIDCGDLVFSFGDSRDFVEKMEAHAGKLLSFGKR
CLSLGGDHFITLPLLRAHARYFGKLALIHFDAHTDTYDNGSEYDHGTMFYTAPKEGLIDP
SRSVQIGIRTEHSKKLPFTVLSAPKVNEDSVEETVRKIKETVGNMPVYLTFDIDCLDPSF
APGTGTPVCGGLSSDRALKILRGLTDLDIVGMDVVEVAPSYDQSDITALAGATIALEMLY
LQGAKKD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacagcacactggcaggacaaaccgacaactccctcgtttccaataatttcggg
tttttgcgcctgccgcttaattttatgccgtatgaaagccatgccgattgggttattacc
ggcgtgccttatgatatggcggtttcagggcgttccggcgcgcgtttcggtcctgaagcc
atccggcgcgcctccgtcaacctcgcttgggagcaccgcaggtttccgtggacatttgat
gtgcgcgaacgcctgaacattattgattgcggcgacttggttttttcttttggcgacagc
agggattttgtcgaaaaaatggaagcgcacgccggcaaattactttctttcggcaaacgc
tgtttgagtttgggcggcgaccatttcattaccctcccgttgttgcgcgcccacgcccgc
tatttcggcaaactcgcactgattcattttgacgcgcacaccgacacctacgacaacggc
agcgaatacgaccacggcacgatgttttataccgcccccaaggaaggcctcatcgacccg
tcccgttccgtacaaatcggcatacgcaccgaacacagtaaaaaattgccttttactgtg
ttgtccgcccccaaagtcaatgaagacagtgttgaagagaccgtccgtaaaatcaaagaa
accgtcggcaatatgcccgtttacctgactttcgacatagactgtctcgacccgtcgttc
gcccccgggaccggtacgcccgtatgcggcggcttgagcagcgacagggcattaaaaatc
ctacgtgggctgacggatctcgacatcgtcggtatggatgttgtagaagttgccccctct
tacgaccaatccgacattaccgctttggccggcgccacaattgccttggaaatgctttac
cttcaaggtgcgaaaaaggactga

DBGET integrated database retrieval system