KEGG   Neisseria gonorrhoeae NCCP11945: NGK_2087Help
Entry
NGK_2087          CDS       T00728                                 

Definition
protein FolA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ngk00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ngk00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1720543..1721073)
Genome map
AA seq 176 aa AA seqDB search
MPSEAFRRHFCGENMLKITIIAACAENLCIGAGNAMPWHIPEDFAFFKVYTLGKPVIMGR
KTWESLPVKPLPGRRNIVISRQADYCAAGAETVASLEAALALCAGAEEAVIMGGAQIYGQ
AMPLATDLRITEVDLSVEGDAFFPEIDRTHWKEAERTERRVSSKGVAYTFVHYLKG
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaagcgttcagacggcatttttgtggagaaaatatgctcaaaataaccata
attgcggcgtgtgcggaaaacctgtgcatcggggcgggcaatgctatgccttggcacatc
cccgaagatttcgcatttttcaaagtctataccttgggcaaacccgtcattatggggcgg
aaaacgtgggaatccctgcccgtcaaacccctgcccggacggaggaacatcgtcatcagc
cggcaggcggattattgcgcggcaggcgcggaaacggtggcaagtttggaggcggcattg
gcattgtgcgccggcgcggaagaagccgtcattatgggcggcgcgcagatatacggacaa
gcgatgccattagcgaccgatttgcggataaccgaagtggatttgtctgtggaaggagat
gcatttttcccagaaatagaccggacgcattggaaagaagcagagcggacggaacgccgt
gtcagcagcaaaggcgttgcatatacattcgtgcattacctcaagggataa

DBGET integrated database retrieval system