KEGG   Neisseria gonorrhoeae NCCP11945: NGK_2570Help
Entry
NGK_2570          CDS       T00728                                 

Definition
PolA
Orthology
K02335  
DNA polymerase I [EC:2.7.7.7]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Homologous recombination
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ngk00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ngk00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ngk03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ngk03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ngk03420]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ngk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2157852..2160578
Genome map
AA seq 908 aa AA seqDB search
MGQNLTAPDGAPTGALYGVLNMLRRLRSEYPHDYCAVVFDAKGKNFRHQMFEEYKATRPP
MPDDLRPQAEALPDLVRLTGWPVLVIGQVEADDVIGTLAKQGAEHGLRVIVSTGDKDMAQ
LVDERVTLVNTMSGETLDIEGVKAKFGVRPDQIRDYLALIGDKVDNVPGVEKCGPKTAVK
WLEAYGSLQGVMEHAPEIKGKVGENLQAALPQLPLSYDLVTIKTDVDLHTELSDGIESLR
RTAPKWAQLAVDFKRWGFRTWLKEAESNMNTGSTDDLFGSDSIGEQAALNAEIPSEKRAE
KATAPEKLDYQAVTTEAQFAALLDKLAKADTIGIDTETTSLDAMNAELVGISIAFQAGEA
VYIPVGHSLTAAPEQLDLQDVLGRLKPHLENPALKKIGQNLKYDQHVFANYGIALNNIAG
DAMLASYIIESHLGHGLDELSGRWLGLETITYESLCGKGAKQISFADVAIGQATEYAAQD
ADFALRLEARLRAQMDDKQLEMYEKMELPVAQVLFEMECNGVQIDRAELARQSAELGAEL
MKLEQEAYAAAGQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGISTNEAVLEQLAPDY
PLPKIILQNRSLAKLKSTYTDKLPEMISPRDNRVHTTYAQAVAITGRLASNNPNLQNIPI
RTAEGRRVRRAFTAPPGSVIVSADYSQIELRIMAHLSGDKTLIAAFQSGEDVHRRTAAEV
FGTAPENVSPEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKNFIDRYFARYPGVAEY
MQRTKEQAAAQGYVETLFGRRLYLPDIRNKNANARAGAERAAINAPMQGTASDLIKRAMI
NVRNWLSDGIGSKLVMQVHDELVLEVVETELDFVKEKLPQIMAKVDGGLLDVPLVAEVGV
GENWEEAH
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggggcaaaacctgactgcgcctgacggtgcgccgacgggtgcgctgtatggcgtattg
aatatgttgcgccgtttgcggtcggaatatccgcacgattattgcgcggtggtttttgat
gcgaaaggcaaaaatttccgccatcaaatgtttgaagaatacaaggcgacgcgcccgccg
atgccggacgatttgcgcccgcaggcggaagccctgccggatttggtgcgcctgacgggc
tggccggtattggtgattgggcaagtggaggcggacgatgtgatcggcacgctggcgaaa
cagggggcggaacatggtttgcgagtcattgtttcgacgggcgataaggatatggcgcag
ttggtggatgagcgcgttacgctggtgaacacgatgagcggagaaacgctggatattgaa
ggcgtgaaggcaaaattcggcgttcgccccgaccaaatccgcgattatctcgcgctgatc
ggcgacaaggtggacaacgtaccgggcgtggaaaaatgcggcccgaaaacggcggtgaaa
tggctggaagcctacggttcgttgcaaggcgtgatggaacacgctccggaaatcaaaggc
aaggtcggcgaaaacctgcaagccgcgctgccccaactgccgctgtcgtatgatttggtc
acgattaaaaccgatgtggacttgcacaccgagctttcagacggcatcgaaagcctgcgc
cgtaccgcgccgaaatgggcgcagcttgcggttgatttcaaacgctggggcttccgtact
tggctgaaagaagcggaatcaaacatgaataccggctcgaccgatgatttgttcggtagc
gacagcatcggcgagcaggcggctttgaatgcggaaataccgtctgaaaaacgagctgaa
aaagccaccgcccctgaaaaactggattatcaagccgttaccaccgaagctcagtttgcc
gccttgttggacaaactagcgaaggcggacacaatcggcattgatacggaaaccacgtca
ttagatgcgatgaatgccgagctggtcggcatcagcattgcgttccaagcaggcgaagcg
gtttacatccccgtaggccacagcctgactgccgcgcccgaacagcttgatttgcaagac
gtattaggccgtctgaagccgcatttggaaaaccccgccctgaaaaaaatcggtcaaaac
ctcaaatacgaccaacacgttttcgccaactacggcatcgcgttaaacaacattgccggc
gacgcgatgctcgcttcctacatcatcgagagccatctcggacacggcttggacgaattg
tccggacgctggctcggtttagaaaccattacctacgaatcgctgtgcggcaaaggcgcg
aagcaaatcagttttgccgatgtcgccatcgggcaggcgaccgaatacgccgcccaagat
gccgatttcgccctgcgcctcgaagcgcgcctgcgcgcgcaaatggacgacaaacaactt
gaaatgtatgaaaaaatggagcttcccgtcgcgcaggtattgtttgaaatggaatgcaac
ggcgtgcaaatcgaccgcgccgaactcgcccgccaaagcgcggaactcggcgcggagctg
atgaagctcgaacaggaagcctacgccgctgcaggtcaaccgtttaacctcaactcgccc
aaacagctgcaagaaatcctgttcgacaaaatgggcatcccgacaaaagggctgaaaaaa
accgccaaaggcggcatttccaccaacgaagccgtgctcgaacagctcgcgcccgactac
cccctgcccaaaatcatcctgcaaaaccgcagcctggcgaaactcaaatccacctacacc
gacaaactgcccgaaatgatttcgccccgggataaccgcgtgcataccacctatgcccaa
gccgtcgccattaccggccgcctcgccagcaacaaccccaacctgcaaaacatccccatt
cgcaccgccgaaggccgccgcgtgcgccgcgccttcactgcaccgccgggcagcgtcatc
gtttccgccgactattcccaaatcgagctgcgcattatggcgcacctctccggtgacaaa
accctcattgccgcatttcaaagcggcgaagacgtacaccgccgcaccgccgccgaagtg
ttcggcactgcgcccgaaaacgtctcgcccgagcaacgccgctacgccaaaaccatcaac
ttcggcttaatctacggtatggggcaatacggtttggcaaaatcattgggcatcgacaac
ctttccgccaaaaactttatcgaccgctacttcgcccgttatcccggcgtcgccgaatac
atgcagcgcaccaaagaacaagccgccgcccaaggctacgtcgaaaccctgttcggcaga
aggctctatttgcccgacatccgcaacaaaaacgccaacgcccgcgcaggagccgagcgt
gccgccatcaacgcccccatgcaaggcaccgcttccgacctcatcaaacgcgccatgata
aacgtgcgaaactggctttcagacggcatcggcagcaaactggtcatgcaggtgcatgac
gaactggtgctggaagtcgttgaaaccgaactggattttgtcaaagaaaaactgccgcag
attatggcgaaagtggacggcggattattggatgtaccgctggtggctgaggttggcgta
ggggagaattgggaagaggcacattga

DBGET integrated database retrieval system