KEGG   Neisseria gonorrhoeae NCCP11945: NGK_2570Help
Entry
NGK_2570          CDS       T00728                                 

Definition
(GenBank) PolA
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk00230  Purine metabolism
ngk00240  Pyrimidine metabolism
ngk01100  Metabolic pathways
ngk03030  DNA replication
ngk03410  Base excision repair
ngk03420  Nucleotide excision repair
ngk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NGK_2570
   00240 Pyrimidine metabolism
    NGK_2570
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NGK_2570
   03410 Base excision repair
    NGK_2570
   03420 Nucleotide excision repair
    NGK_2570
   03440 Homologous recombination
    NGK_2570
Enzymes [BR:ngk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NGK_2570
DNA replication proteins [BR:ngk03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     NGK_2570
DNA repair and recombination proteins [BR:ngk03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     NGK_2570
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     NGK_2570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A 5_3_exonuc_N DNA_pol_A_exo1 5_3_exonuc
Motif
Other DBs
NCBI-ProteinID: ACF31169
UniProt: B4RRB2
Position
2157852..2160578
Genome map
AA seq 908 aa AA seqDB search
MGQNLTAPDGAPTGALYGVLNMLRRLRSEYPHDYCAVVFDAKGKNFRHQMFEEYKATRPP
MPDDLRPQAEALPDLVRLTGWPVLVIGQVEADDVIGTLAKQGAEHGLRVIVSTGDKDMAQ
LVDERVTLVNTMSGETLDIEGVKAKFGVRPDQIRDYLALIGDKVDNVPGVEKCGPKTAVK
WLEAYGSLQGVMEHAPEIKGKVGENLQAALPQLPLSYDLVTIKTDVDLHTELSDGIESLR
RTAPKWAQLAVDFKRWGFRTWLKEAESNMNTGSTDDLFGSDSIGEQAALNAEIPSEKRAE
KATAPEKLDYQAVTTEAQFAALLDKLAKADTIGIDTETTSLDAMNAELVGISIAFQAGEA
VYIPVGHSLTAAPEQLDLQDVLGRLKPHLENPALKKIGQNLKYDQHVFANYGIALNNIAG
DAMLASYIIESHLGHGLDELSGRWLGLETITYESLCGKGAKQISFADVAIGQATEYAAQD
ADFALRLEARLRAQMDDKQLEMYEKMELPVAQVLFEMECNGVQIDRAELARQSAELGAEL
MKLEQEAYAAAGQPFNLNSPKQLQEILFDKMGIPTKGLKKTAKGGISTNEAVLEQLAPDY
PLPKIILQNRSLAKLKSTYTDKLPEMISPRDNRVHTTYAQAVAITGRLASNNPNLQNIPI
RTAEGRRVRRAFTAPPGSVIVSADYSQIELRIMAHLSGDKTLIAAFQSGEDVHRRTAAEV
FGTAPENVSPEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKNFIDRYFARYPGVAEY
MQRTKEQAAAQGYVETLFGRRLYLPDIRNKNANARAGAERAAINAPMQGTASDLIKRAMI
NVRNWLSDGIGSKLVMQVHDELVLEVVETELDFVKEKLPQIMAKVDGGLLDVPLVAEVGV
GENWEEAH
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggggcaaaacctgactgcgcctgacggtgcgccgacgggtgcgctgtatggcgtattg
aatatgttgcgccgtttgcggtcggaatatccgcacgattattgcgcggtggtttttgat
gcgaaaggcaaaaatttccgccatcaaatgtttgaagaatacaaggcgacgcgcccgccg
atgccggacgatttgcgcccgcaggcggaagccctgccggatttggtgcgcctgacgggc
tggccggtattggtgattgggcaagtggaggcggacgatgtgatcggcacgctggcgaaa
cagggggcggaacatggtttgcgagtcattgtttcgacgggcgataaggatatggcgcag
ttggtggatgagcgcgttacgctggtgaacacgatgagcggagaaacgctggatattgaa
ggcgtgaaggcaaaattcggcgttcgccccgaccaaatccgcgattatctcgcgctgatc
ggcgacaaggtggacaacgtaccgggcgtggaaaaatgcggcccgaaaacggcggtgaaa
tggctggaagcctacggttcgttgcaaggcgtgatggaacacgctccggaaatcaaaggc
aaggtcggcgaaaacctgcaagccgcgctgccccaactgccgctgtcgtatgatttggtc
acgattaaaaccgatgtggacttgcacaccgagctttcagacggcatcgaaagcctgcgc
cgtaccgcgccgaaatgggcgcagcttgcggttgatttcaaacgctggggcttccgtact
tggctgaaagaagcggaatcaaacatgaataccggctcgaccgatgatttgttcggtagc
gacagcatcggcgagcaggcggctttgaatgcggaaataccgtctgaaaaacgagctgaa
aaagccaccgcccctgaaaaactggattatcaagccgttaccaccgaagctcagtttgcc
gccttgttggacaaactagcgaaggcggacacaatcggcattgatacggaaaccacgtca
ttagatgcgatgaatgccgagctggtcggcatcagcattgcgttccaagcaggcgaagcg
gtttacatccccgtaggccacagcctgactgccgcgcccgaacagcttgatttgcaagac
gtattaggccgtctgaagccgcatttggaaaaccccgccctgaaaaaaatcggtcaaaac
ctcaaatacgaccaacacgttttcgccaactacggcatcgcgttaaacaacattgccggc
gacgcgatgctcgcttcctacatcatcgagagccatctcggacacggcttggacgaattg
tccggacgctggctcggtttagaaaccattacctacgaatcgctgtgcggcaaaggcgcg
aagcaaatcagttttgccgatgtcgccatcgggcaggcgaccgaatacgccgcccaagat
gccgatttcgccctgcgcctcgaagcgcgcctgcgcgcgcaaatggacgacaaacaactt
gaaatgtatgaaaaaatggagcttcccgtcgcgcaggtattgtttgaaatggaatgcaac
ggcgtgcaaatcgaccgcgccgaactcgcccgccaaagcgcggaactcggcgcggagctg
atgaagctcgaacaggaagcctacgccgctgcaggtcaaccgtttaacctcaactcgccc
aaacagctgcaagaaatcctgttcgacaaaatgggcatcccgacaaaagggctgaaaaaa
accgccaaaggcggcatttccaccaacgaagccgtgctcgaacagctcgcgcccgactac
cccctgcccaaaatcatcctgcaaaaccgcagcctggcgaaactcaaatccacctacacc
gacaaactgcccgaaatgatttcgccccgggataaccgcgtgcataccacctatgcccaa
gccgtcgccattaccggccgcctcgccagcaacaaccccaacctgcaaaacatccccatt
cgcaccgccgaaggccgccgcgtgcgccgcgccttcactgcaccgccgggcagcgtcatc
gtttccgccgactattcccaaatcgagctgcgcattatggcgcacctctccggtgacaaa
accctcattgccgcatttcaaagcggcgaagacgtacaccgccgcaccgccgccgaagtg
ttcggcactgcgcccgaaaacgtctcgcccgagcaacgccgctacgccaaaaccatcaac
ttcggcttaatctacggtatggggcaatacggtttggcaaaatcattgggcatcgacaac
ctttccgccaaaaactttatcgaccgctacttcgcccgttatcccggcgtcgccgaatac
atgcagcgcaccaaagaacaagccgccgcccaaggctacgtcgaaaccctgttcggcaga
aggctctatttgcccgacatccgcaacaaaaacgccaacgcccgcgcaggagccgagcgt
gccgccatcaacgcccccatgcaaggcaccgcttccgacctcatcaaacgcgccatgata
aacgtgcgaaactggctttcagacggcatcggcagcaaactggtcatgcaggtgcatgac
gaactggtgctggaagtcgttgaaaccgaactggattttgtcaaagaaaaactgccgcag
attatggcgaaagtggacggcggattattggatgtaccgctggtggctgaggttggcgta
ggggagaattgggaagaggcacattga

DBGET integrated database retrieval system