KEGG   Neisseria gonorrhoeae FA 1090: NGO0220Help
Entry
NGO0220           CDS       T00237                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00040  Pentose and glucuronate interconversions
ngo00052  Galactose metabolism
ngo00500  Starch and sucrose metabolism
ngo00520  Amino sugar and nucleotide sugar metabolism
ngo01100  Metabolic pathways
ngo01130  Biosynthesis of antibiotics
Module
ngo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NGO0220
   00052 Galactose metabolism
    NGO0220
   00500 Starch and sucrose metabolism
    NGO0220
   00520 Amino sugar and nucleotide sugar metabolism
    NGO0220
Enzymes [BR:ngo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NGO0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-GeneID: 3281452
NCBI-ProteinID: YP_207385
UniProt: Q5FA14
Position
complement(223913..224782)
Genome map
AA seq 289 aa AA seqDB search
MKPIKKAVFPVAGMGTRFLPATKANPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRN
KRSIEDHFDKAYELETKLEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARA
AIGDEPFAVILADDLIDAPKGALKQMVEVYGRSGNSILGVETVEPSQTGSYGIVETEQLK
QFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPRGAGNEIQLTDGIAKLLDH
EFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRRLLEKYRTE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgataaaaaaagccgtcttccccgttgcagggatgggaacccgcttcctgccc
gccaccaaggccaacccgaaagaaatgctgcccatcgtcgacaagccgctgatccaatac
gccgtagaagaagccgtggaagccggctgcacggaaatggtgtttgttaccgggcgcaac
aagcgcagcatcgaagaccatttcgacaaggcatacgaactcgaaactaagttggaaatg
cgccataaagacaaattgttggaacacgtccgcaacatcctgccgccgaacattacctgc
ctctacatccgtcaggcggaagcactgggattgggacacgccgtcttgtgcgcccgcgcc
gccatcggcgacgaacccttcgccgtcatccttgccgacgacttaatcgatgcgcccaaa
ggcgcgctcaaacaaatggtcgaagtgtacgggcgcagcggtaacagcattttgggcgta
gaaaccgtcgaaccgtcgcaaaccggctcatacggcatcgtcgaaaccgaacagctcaaa
cagttccaacgcattaccggcattgtcgaaaaacccaagcccgaagacgcgccctccaac
cttgccgttgtcggacgctacatcctcaccccgcgcattttcgaccttttaaccggcctg
ccgcgcggcgcgggcaacgaaatccagcttacagacggcatcgccaagctgctcgatcac
gaatttgtcttggcgcacccctttgaaggcacgcgctacgactgcggcagcaaactcggc
tatctcgaagccaccgtcgcctacggtttaaaacaccccgaaaccggcgaacccttccgc
cgccttttggaaaaataccgcaccgaataa

DBGET integrated database retrieval system