KEGG   Neisseria gonorrhoeae FA 1090: NGO0248Help
Entry
NGO0248           CDS       T00237                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGO0248 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGO0248 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGO0248 (trpA)
Enzymes [BR:ngo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NGO0248 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248915..249700
Genome map
AA seq 261 aa AA seqDB search
MSRIRQAFAALDGGKALIPYIAVGDPDIRTTLALMHGMVASGADILELGVPFSDPMADGP
VIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPIHKMGYREFAQEAAKAG
VDGVLTVDSPIETIDSLYRELKDNEVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGV
TGAASLDTDEVSRKIEYLRQYIDIPIGVGFGISNAESARKIGRVAAAIIVGSRIVKEIEN
NAGNEAAAVGALVKELKDAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatccggcaggcttttgccgctttggatggcggaaaggcattgattccctat
attgcggtgggcgaccccgatattcggacaactttggcattgatgcacggcatggttgca
agcggtgcggatattttggagttgggcgtgccgttttccgatccgatggcggacgggccg
gttattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctgcgcgatgtcttg
gatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgttttgatgggatat
ttgaatcccatacataagatgggttatcgggagtttgctcaggaagccgcaaaggcgggg
gtggacggcgtgttgacggtggattcccccatcgaaaccatcgattctttatatcgcgag
ctgaaggataacgaggtcgactgtattttcctgattgcgccgacgacgacggaagaccgt
attaaaaccattgccgagctggcaggcggatttgtctattatgtttcgctcaagggcgta
acgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagagtatttgcgtcag
tatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaaagcgcgcgcaaa
atcggccgggttgccgccgcgatcattgtcggcagccggattgtgaaagagattgaaaac
aatgcgggcaacgaggctgccgccgtcggtgctttggtcaaagagttaaaggatgccgtg
cgctga

DBGET integrated database retrieval system