KEGG   Neisseria gonorrhoeae FA 1090: NGO0274Help
Entry
NGO0274           CDS       T00237                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGO0274
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGO0274
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGO0274
Enzymes [BR:ngo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NGO0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271016..272218
Genome map
AA seq 400 aa AA seqDB search
MKNYHAPDEKGFFGEHGGLYVSETLIPALKELEQAYNEAKNDPEFWAEFRRDLKHYVGRP
SPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLARRMGKKRVIAETGAGQH
GVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVIGVDSGSRTLKDAMNEAMR
EWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEATGRQPDVAVACVGGGS
NAIGLFYPYIEEENVRLVGVEAGGLGVDTPDHAAPITSGAPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALEAFDLLCRFEGIIPALESSHA
VAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIEL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactaccacgcgcccgacgaaaagggctttttcggcgaacacggcgggctttat
gtttccgaaaccctgattcccgctttgaaagagctggaacaggcctacaacgaagcgaaa
aacgatcctgaattttgggcggagttccgccgcgatttgaaacattatgtcggcaggccc
agccccgtttaccacgccgcgcggttgtccgagcatttgggcggcgcgcaaatctggttg
aagcgcgaagacttgaaccacaccggcgcgcacaaggtcaacaacaccatcggtcaggca
ttgcttgcccgccgtatgggcaaaaaacgcgtcatcgccgaaaccggcgcgggtcagcac
ggcgtggcttctgccaccgtcgccgcacgtttcggcatgacttgcgacgtgtacatgggt
gcggacgatattcaacgccaaatgccgaatgtgttccgtatgaagctgcttggtgcgaat
gtcatcggcgttgacagtggcagccgtactttgaaagacgcgatgaacgaagcgatgcgc
gaatgggtcgcccgagtggacgatacgttctacatcatcggcaccgccgccggccccgcg
ccgtatcccgaaatggtgcgtgatttccaatgcgtcatcggcaacgaagccaaagcgcag
atgcaggaagccaccggcagacagcccgacgtcgccgttgcctgcgtcggcggcggctcg
aacgccatcggtttgttctatccctatatcgaagaagaaaacgtacgtttggtcggcgta
gaagcaggcggtttgggcgtggatacgcctgaccacgccgcgccgattacttcgggcgca
ccgattggcgtactgcacggcttccgcagctatctgatgcaggacgaaaacggccaagtc
ttggggacgcactctgtttccgcaggcttggattaccccggcatcggcccggaacacagc
catctgcacgacatcaagcgcgtcgaatacaccgttgccaaagatgacgaagcactcgaa
gcctttgacttgctctgccgattcgagggcatcatccccgcgctcgaatccagccacgcc
gttgcttgggcggtgaaaaacgcgccgaaaatgggtaaagaccaagtgattttggtcaac
ctgtcgggtcgcggcgacaaagacatcaataccgtggcgaaactcaaaggcattgagctg
tag

DBGET integrated database retrieval system