KEGG   Neisseria gonorrhoeae FA 1090: NGO0385Help
Entry
NGO0385           CDS       T00237                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ngo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
377930..378946
Genome map
AA seq 338 aa AA seqDB search
MIGGLMQFPYRNVPASRMRRMRRDDFSRRLMREHMLTADDLIYPVFVLEGAAREEDVPSM
PGVKRQSLDRLLFTAEEAVKLGIPMLALFPVVTANKTGRAQEAYNPEGLVPSTVRALRER
FSELGIMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAEAGTQVVAPSDMM
DGRIGAIREALEDAGHIHTRIMAYSAKYASAFYGPFRDAVGSSGNLGKADKKTYQMDPAN
TDEALHEVALDIQEGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQVSGEYAMLQAAVAN
GWLDGGKVVLESLLAFKRAGADGILTYYAIEAAKMLKR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgattggagggcttatgcaatttccttaccgcaatgttccggcttcgcgtatgcgccgt
atgcgcagggatgatttttcacgccgcctgatgcgcgagcatatgctgaccgccgatgat
ttgatttatccggtgttcgtattggagggggcggcgcgcgaggaggatgtgccttctatg
ccgggcgtgaagcgtcagagtttggacaggctgctgtttacggcggaagaggcggtgaag
ctcggtattccgatgttggcactctttcccgtggttacggcaaacaaaaccgggcgtgcg
caggaggcgtacaatcccgaaggactcgtgccgtcaactgtccgagccttgcgcgagagg
ttttccgaactgggcattatgacggatgtcgcgctcgatccttatacggtgcacggtcag
gacggactgacggacgaaaacggttacgtgatgaatgatgaaaccgtagaagtcttggtg
aaacaggctttatgtcatgcagaggcgggcacgcaggtcgttgctccttccgatatgatg
gacgggcgtatcggcgccatccgcgaggctttggaggatgccggacatatccatacgcgg
attatggcatattccgccaaatatgcttctgcattctacggccctttccgtgatgcggta
ggcagttcgggcaatttgggaaaggcagataaaaagacctatcagatggatcctgcaaat
accgatgaggcgctgcatgaagtggcgctcgatattcaggaaggtgcggatatggtgatg
gtgaagcccggtttgccgtatttggacgttgtccgccgcgtgaaggacgagttcggcgta
ccgacttatgcctatcaggtttcgggcgaatatgcgatgttgcaggcggcggttgccaac
ggctggctggacggcggcaaagtggttttggaaagcctgctggcattcaaacgtgcgggt
gcggacgggattttgacctattacgccattgaggcggcaaagatgctgaagcgttga

DBGET integrated database retrieval system