KEGG   Neisseria gonorrhoeae FA 1090: NGO0440Help
Entry
NGO0440           CDS       T00237                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00900  Terpenoid backbone biosynthesis
ngo01100  Metabolic pathways
ngo01110  Biosynthesis of secondary metabolites
ngo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NGO0440 (ipk)
Enzymes [BR:ngo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NGO0440 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 3282196
NCBI-ProteinID: YP_207593
UniProt: Q5F9F6
Position
434303..435148
Genome map
AA seq 281 aa AA seqDB search
MNIADGRQAFPAPAKLNLDLRITGRREDGYHNIESIFCLIDLQDTVYLKPRDDGKIILHN
PVGGIPQEADLSYRAASLLQKYARNLAGVEIWLDKKIPTGAGLGGGSSDAATVLLVLNRW
WQCGLTQWQLIDLGAALGADVPFFIFGKNAFASGIGKKLIGMDIPKQWYVIVKPPVHVST
AKIFTYEGLTRDSASSIMPTFQNLQPFRNDMQAVVFKEYPEVWKAYSELSKYGSAMMTGS
GACIFAAFQARNSAYNIYRQVSGLYEAYLAEGLSKHPLLSV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcggacggacggcaggcgtttcccgcacctgcaaaactgaatctcgatttg
aggattaccggcaggcgggaagacggttatcacaatatcgaaagcatattctgcctgata
gatttgcaggataccgtatatttgaaaccgagggacgacggcaaaatcatcctgcacaat
cctgtcggcggaataccgcaggaagccgatttgagctaccgtgccgcatcgttgctgcaa
aaatatgcgcgcaaccttgccggcgtggaaatatggctggacaaaaaaatcccgaccggc
gccggcttgggaggggggagttccgatgccgcaacggttttgctggtgttgaaccgttgg
tggcagtgtggtttgacgcagtggcagctcattgatttgggtgcggctttgggtgcggac
gtaccgttttttattttcggaaaaaatgcttttgcaagcgggataggtaaaaaactgata
ggaatggatattccgaaacagtggtatgttattgtcaaacctcccgtccacgtttccacc
gcaaaaattttcacatacgaaggcttgacacgggattctgcctcaagcataatgccgact
ttccaaaacctgcaaccgttcagaaacgatatgcaggcagtggtatttaaagaataccct
gaagtttggaaagcttattccgagttgtcgaaatacggttctgcaatgatgaccggctca
ggagcctgtatatttgcagcatttcaagctaggaatagcgcatacaatatataccgacaa
gtttcaggtttgtacgaggcatatttggcagagggtctttcaaaacatcctttgttgtcc
gtataa

DBGET integrated database retrieval system